Result : Q82W51
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | CRISPR-associated endoribonuclease Cas2 3 (EC 3.1.-.-) |
| NCBI Accession ID | AL954747.1 |
| Organism | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
| Left | 920552 |
| Right | 920842 |
| Strand | + |
| Nucleotide Sequence | ATGCTGATCATTGTTACTTACGATGTTTCAACGGAAACCAGAGCAGGTCGCAAGCGATTGCGCCGTGTTGCAAAATTATGTGAAAGTATCGGGCAACGTGTGCAAAAATCTGTATTTGAATGTCGTATCAATTTAATGCAGTATGAGGAGCTGGAGCGTCGTTTACTGTCTGAAATAGACGAACAGGAAGATAATCTGCGGCTATATCGCCTGACCGAACCGGCGGAGCTCCATGTAAAAGAGTATGGCAATTTTAAGGCAATTGATTTTGAAGGACCTCTCACTATCTGA |
| Sequence | MLIIVTYDVSTETRAGRKRLRRVAKLCESIGQRVQKSVFECRINLMQYEELERRLLSEIDEQEDNLRLYRLTEPAELHVKEYGNFKAIDFEGPLTI |
| Source of smORF | Swiss-Prot |
| Function | CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Involved in the integration of spacer DNA into the CRISPR cassette (By similarity). Functions as a ssRNA-specific endoribonuclease. {ECO:0000250, ECO:0000269|Pubmed:18482976}. |
| Pubmed ID | 12700255 18482976 |
| Domain | CDD:416272 |
| Functional Category | Metal-binding |
| Uniprot ID | Q82W51 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 920552 | 920842 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 2 | 1045070 | 1045360 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 3 | 2644493 | 2644783 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 4 | 684633 | 684923 | - | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 5 | 3159159 | 3159449 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 6 | 2009885 | 2010175 | + | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 7 | 2657597 | 2657887 | + | NZ_CP038033.1 | Nitrosococcus wardiae |
| 8 | 2421112 | 2421405 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 9 | 406045 | 406335 | - | NZ_CP017237.1 | Moorella thermoacetica |
| 10 | 3767878 | 3768171 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 11 | 1515994 | 1516284 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 12 | 2336392 | 2336682 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 13 | 1493793 | 1494083 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 14 | 4364941 | 4365231 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 15 | 3734437 | 3734727 | + | NZ_CP040709.1 | Inhella inkyongensis |
| 16 | 2498178 | 2498468 | + | NZ_CP022423.1 | Vitreoscilla filiformis |
| 17 | 2494469 | 2494759 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 18 | 371614 | 371904 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 19 | 1953763 | 1954053 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 20 | 1237064 | 1237354 | - | NC_010524.1 | Leptothrix cholodnii SP-6 |
| 21 | 1194577 | 1194870 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 22 | 1146578 | 1146868 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 23 | 1102930 | 1103220 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 24 | 1519008 | 1519298 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 25 | 5104706 | 5104996 | - | NZ_CP026363.1 | Brevibacillus agri |
| 26 | 863901 | 864191 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 27 | 2614592 | 2614882 | + | NZ_CP029829.1 | Azospirillum ramasamyi |
| 28 | 273597 | 273863 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 29 | 1552076 | 1552348 | + | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 30 | 601110 | 601400 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 31 | 420679 | 420969 | + | NZ_CP044117.1 | Roseomonas mucosa |
| 32 | 1786551 | 1786841 | - | NZ_CP030265.1 | Skermanella pratensis |
| 33 | 1680364 | 1680654 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 34 | 1098091 | 1098381 | - | NZ_CP025612.1 | Niveispirillum cyanobacteriorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008344.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01867.18 | 0.85 | 29 | 11 | same-strand | CRISPR associated protein Cas1 |
| 2 | PF01930.19 | 0.94 | 32 | 1054.5 | same-strand | Domain of unknown function DUF83 |
| 3 | PF05107.14 | 0.82 | 28 | 1763.5 | same-strand | CRISPR-associated protein Cas7 |
| 4 | PF09709.12 | 0.68 | 23 | 2672 | same-strand | CRISPR-associated protein (Cas Csd1) |
++ More..