Result : Q82VD5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AL954747.1 |
| Organism | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
| Left | 1258933 |
| Right | 1259202 |
| Strand | + |
| Nucleotide Sequence | ATGAGAAAAAAATCATCATCGAACAAAGAAGAAACAGCATTACATCCGCCACCGGAAAATTTTGAAACAGCCACGGCCGAACTGGAACAGATCGTAGCCGGCATGGAAACCGGGCAAATGTCTCTGGAAGATGCGCTTTCTGCGTACAAACGCGGGGTGGAATTGTTACAATACTGCCAAAATATACTGAAAAATTCGCAACAACAGATAAAAATACTTGAGGCGGATATGCTGAAACACTTCTCACCTGCTGAGCACGATGCATCCTGA |
| Sequence | MRKKSSSNKEETALHPPPENFETATAELEQIVAGMETGQMSLEDALSAYKRGVELLQYCQNILKNSQQQIKILEADMLKHFSPAEHDAS |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 12700255 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q82VD5 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1258933 | 1259202 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 2 | 1570112 | 1570378 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 3 | 1657664 | 1657933 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 4 | 3922465 | 3922704 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 5 | 1542492 | 1542746 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 6 | 2786351 | 2786626 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 7 | 667994 | 668260 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 8 | 1951278 | 1951544 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 9 | 1680602 | 1680868 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 10 | 1313895 | 1314149 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 11 | 4655221 | 4655442 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 12 | 2070757 | 2071011 | - | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 13 | 4343375 | 4343641 | + | NZ_LR134302.1 | Achromobacter spanius |
| 14 | 3208904 | 3209125 | - | NC_010170.1 | Bordetella petrii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP012547.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00348.19 | 1.0 | 14 | -6.5 | same-strand | Polyprenyl synthetase |
| 2 | PF13292.8 | 1.0 | 14 | 937.5 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 3 | PF02779.26 | 1.0 | 14 | 937.5 | same-strand | Transketolase, pyrimidine binding domain |
| 4 | PF02780.22 | 1.0 | 14 | 937.5 | same-strand | Transketolase, C-terminal domain |
| 5 | PF02649.16 | 1.0 | 14 | 2964.5 | same-strand | Type I GTP cyclohydrolase folE2 |
| 6 | PF00848.21 | 0.64 | 9 | 3386 | opposite-strand | Ring hydroxylating alpha subunit (catalytic domain) |
++ More..