Result : Q82SG6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | AL954747.1 |
| Organism | Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
| Left | 2578852 |
| Right | 2579085 |
| Strand | + |
| Nucleotide Sequence | ATGAATCATCAGGCCCGCATGCGCTGGCGTTGTCGTCGCGGCATGCTGGAACTGGACATCGTCCTGCAGCGTTTCATAGACAATCATTATGAACAGCTGGATGAACACCAGCTTGAGCTGTTTGAAATGCTACTGTCGCTTTCCGATCACGACCTGTGGAACATAATTATTGGCAACACTAAAGAGCCCAATAATCAGTTTCAGCCTGTATTGAAACTTTTACAGGAAAATTGA |
| Sequence | MNHQARMRWRCRRGMLELDIVLQRFIDNHYEQLDEHQLELFEMLLSLSDHDLWNIIIGNTKEPNNQFQPVLKLLQEN |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | 12700255 |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q82SG6 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2578852 | 2579085 | + | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 2 | 880334 | 880567 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 3 | 2296225 | 2296458 | + | NZ_AP019755.1 | Nitrosomonas stercoris |
| 4 | 3085154 | 3085387 | - | NZ_CP013341.1 | Nitrosomonas ureae |
| 5 | 1430076 | 1430309 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 6 | 892374 | 892607 | + | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 7 | 3650324 | 3650557 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 8 | 978763 | 978957 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004757.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13085.8 | 1.0 | 8 | -3.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 2 | PF13534.8 | 1.0 | 8 | -3.0 | same-strand | 4Fe-4S dicluster domain |
| 3 | PF13237.8 | 1.0 | 8 | -3.0 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13183.8 | 1.0 | 8 | -3.0 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13187.8 | 0.88 | 7 | -3 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF00285.23 | 1.0 | 8 | 58.0 | same-strand | Citrate synthase, C-terminal domain |
| 7 | PF02779.26 | 1.0 | 8 | 1485.0 | same-strand | Transketolase, pyrimidine binding domain |
| 8 | PF00676.22 | 1.0 | 8 | 1485.0 | same-strand | Dehydrogenase E1 component |
| 9 | PF16870.7 | 1.0 | 8 | 1485.0 | same-strand | 2-oxoglutarate dehydrogenase C-terminal |
| 10 | PF16078.7 | 1.0 | 8 | 1485.0 | same-strand | 2-oxoglutarate dehydrogenase N-terminus |
| 11 | PF00198.25 | 1.0 | 8 | 4372.5 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 12 | PF00364.24 | 1.0 | 8 | 4372.5 | same-strand | Biotin-requiring enzyme |
| 13 | PF02817.19 | 1.0 | 8 | 4372.5 | same-strand | e3 binding domain |
++ More..