Protein name |
UPF0337 protein NE2439 |
NCBI Accession ID |
|
Organism |
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
|
Sequence |
MMGWNTVERNWKELKGKLKETWGDMTDDELDVIAGKREQLVGKIQTKYEIAREEAERQVNAFAHDCDAAKEPLKNVGEAVSSRQKSVKKRSLYT |
Source of smORF |
Swiss-Prot |
Function |
The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
Pubmed ID |
12700255
|
Domain |
CDD:419889 |
Functional Category |
Others |
Uniprot ID |
Q82SA7
|
ORF Length (Amino Acid) |
94 |