Result : Q820D5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | AE014184.1 |
| Organism | Tropheryma whipplei (strain Twist) (Whipple's bacillus) |
| Left | 447927 |
| Right | 448223 |
| Strand | - |
| Nucleotide Sequence | TTGGAAAATGTAAATACTTTTCTGGAAAAGGTTTTGTATATGGAAGAAGATCGCGGAATAGCAGATCCACCTCTTGATTCTTTGCTCAGCAGGTCGGGTTCAAAATATGGCCTTGTGATCTATGCGGCTAAACGCGCGCGGCAGATAGATCAGTACTATATTGACCTGCATGAAGGGTCGTTTTATGCTCATGTTGGGCCGCTTGTTTCTGTTGATGCTGATGATAAGTCCCTTACAGTCGCAATGCGTGAGATTGCCGAGGATAAACTCGATCTTAAGTCTTCTGCAGCCGAGTGA |
| Sequence | MENVNTFLEKVLYMEEDRGIADPPLDSLLSRSGSKYGLVIYAAKRARQIDQYYIDLHEGSFYAHVGPLVSVDADDKSLTVAMREIAEDKLDLKSSAAE |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 12902375 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q820D5 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 447927 | 448223 | - | NC_004572.3 | Tropheryma whipplei str. Twist |
| 2 | 1978037 | 1978297 | - | NZ_CP020715.1 | Cnuibacter physcomitrellae |
| 3 | 1133894 | 1134157 | + | NC_022438.1 | Leifsonia xyli subsp. cynodontis DSM 46306 |
| 4 | 1454990 | 1455244 | - | NZ_CP031423.1 | Microbacterium lemovicicum |
| 5 | 1433646 | 1433900 | + | NZ_CP031421.1 | Microbacterium oleivorans |
| 6 | 2538906 | 2539163 | + | NZ_CP035491.1 | Agromyces protaetiae |
| 7 | 2772196 | 2772450 | - | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 8 | 3349549 | 3349812 | - | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 9 | 2158437 | 2158694 | + | NZ_CP013979.1 | Agromyces aureus |
| 10 | 1546846 | 1547103 | - | NZ_CP026949.1 | Mycetocola zhujimingii |
| 11 | 3209545 | 3209799 | + | NZ_CP061344.1 | Microbacterium hominis |
| 12 | 1908157 | 1908411 | + | NZ_CP031422.1 | Microbacterium oxydans |
| 13 | 1463112 | 1463366 | + | NZ_CP047186.1 | Rathayibacter tanaceti |
| 14 | 444576 | 444833 | - | NZ_CP049253.1 | Microbacterium amylolyticum |
| 15 | 1098690 | 1098944 | + | NZ_CP028129.1 | Rathayibacter rathayi |
| 16 | 1705952 | 1706209 | - | NZ_CP028913.1 | Agromyces badenianii |
| 17 | 1760088 | 1760342 | - | NZ_CP044232.1 | Microbacterium lushaniae |
| 18 | 1789882 | 1790136 | - | NZ_CP038266.1 | Microbacterium wangchenii |
| 19 | 79998 | 80243 | + | NZ_CP049255.1 | Microbacterium endophyticum |
| 20 | 3280885 | 3281178 | + | NZ_CP035806.1 | Leucobacter triazinivorans |
| 21 | 3570397 | 3570663 | + | NZ_CP049863.1 | Leucobacter viscericola |
| 22 | 1339048 | 1339314 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 23 | 606383 | 606634 | - | NZ_CP060716.1 | Leucobacter denitrificans |
| 24 | 559535 | 559816 | + | NZ_CP018135.1 | Neomicrococcus aestuarii |
| 25 | 1930654 | 1930911 | - | NZ_CP013745.1 | Arthrobacter alpinus |
| 26 | 1595656 | 1595916 | - | NZ_LR131272.1 | Arthrobacter agilis |
| 27 | 1733652 | 1733951 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 28 | 1899708 | 1899971 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 29 | 1828800 | 1829114 | - | NZ_CP013290.1 | Janibacter indicus |
| 30 | 3402443 | 3402721 | + | NZ_AP017900.1 | Nocardia seriolae |
| 31 | 207682 | 207942 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 32 | 2926797 | 2927060 | + | NZ_CP011112.1 | Luteipulveratus mongoliensis |
| 33 | 2181546 | 2181809 | - | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 34 | 623583 | 623864 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 35 | 1686294 | 1686551 | - | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 36 | 2573797 | 2574075 | + | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 37 | 8678160 | 8678438 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 38 | 1945863 | 1946123 | - | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 39 | 1866178 | 1866438 | - | NZ_CP033081.1 | Glutamicibacter nicotianae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP020715.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02911.20 | 0.69 | 27 | 4580 | same-strand | Formyl transferase, C-terminal domain |
| 2 | PF17764.3 | 0.97 | 38 | 2517.5 | same-strand | 3'DNA-binding domain (3'BD) |
| 3 | PF02773.18 | 1.0 | 39 | 1300 | same-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 4 | PF02772.18 | 1.0 | 39 | 1300 | same-strand | S-adenosylmethionine synthetase, central domain |
| 5 | PF00438.22 | 1.0 | 39 | 1300 | same-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 6 | PF04127.17 | 0.69 | 27 | 16 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 7 | PF02441.21 | 0.69 | 27 | 16 | same-strand | Flavoprotein |
| 8 | PF00625.23 | 0.87 | 34 | 67.5 | same-strand | Guanylate kinase |
| 9 | PF02786.19 | 0.69 | 27 | 1923.0 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 10 | PF02787.21 | 0.69 | 27 | 1923 | same-strand | Carbamoyl-phosphate synthetase large chain, oligomerisation domain |
| 11 | PF02142.24 | 0.69 | 27 | 1923 | same-strand | MGS-like domain |
| 12 | PF00988.24 | 0.67 | 26 | 5216.5 | same-strand | Carbamoyl-phosphate synthase small chain, CPSase domain |
| 13 | PF00117.30 | 0.67 | 26 | 5216.5 | same-strand | Glutamine amidotransferase class-I |
| 14 | PF00551.21 | 0.69 | 27 | 4580 | same-strand | Formyl transferase |
| 15 | PF00215.26 | 0.77 | 30 | 1077.0 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
++ More..