Result : Q81R17
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AE016879.1 |
| Organism | Bacillus anthracis |
| Left | 2094092 |
| Right | 2094277 |
| Strand | + |
| Nucleotide Sequence | ATGTTTTCAAATATTGGCTTTCCAGGATTAATTTTAATTTTAGTAGCTGTACTTATTTTATTTGGGCCTAAAAAATTGCCGGAAATCGGAAAGGCCTTAGGGGAAACGTTAAAAGAATTCAAAAAATCAACGAAAGAATTGACTGATGATGCATTTCAAGAGAAGGAAAAGAAAGAAAAAATGTAA |
| Sequence | MFSNIGFPGLILILVAVLILFGPKKLPEIGKALGETLKEFKKSTKELTDDAFQEKEKKEKM |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 12721629 18952800 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q81R17 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 90
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2986928 | 2987113 | - | NZ_CP040336.1 | Bacillus luti |
| 2 | 2094216 | 2094401 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 2133781 | 2133966 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 2128412 | 2128597 | + | NC_011725.1 | Bacillus cereus B4264 |
| 5 | 2163288 | 2163473 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 6 | 805326 | 805529 | + | NZ_CP012502.1 | Bacillus beveridgei |
| 7 | 1743094 | 1743270 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 8 | 4847050 | 4847256 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 9 | 1340837 | 1341031 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 10 | 2356867 | 2357073 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 11 | 2357099 | 2357293 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 12 | 2877035 | 2877232 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 13 | 3675772 | 3675981 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 14 | 3299669 | 3299848 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 15 | 3155559 | 3155750 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 16 | 698941 | 699114 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 17 | 3765887 | 3766084 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 18 | 1000882 | 1001088 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 19 | 3120471 | 3120677 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 20 | 3120699 | 3120899 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 21 | 3527267 | 3527455 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 22 | 418527 | 418709 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 23 | 3998160 | 3998342 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 24 | 893581 | 893754 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 25 | 6239989 | 6240171 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 26 | 2330868 | 2331068 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 27 | 2218272 | 2218454 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 28 | 2218469 | 2218651 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 29 | 312156 | 312368 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 30 | 471189 | 471377 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 4943354 | 4943545 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 32 | 4898137 | 4898325 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 33 | 2213373 | 2213558 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 34 | 2213128 | 2213322 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 35 | 4318051 | 4318233 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 36 | 1326386 | 1326583 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 37 | 287110 | 287316 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 38 | 5458333 | 5458515 | + | NZ_CP034437.1 | Paenibacillus albus |
| 39 | 3828595 | 3828783 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 40 | 351450 | 351644 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 41 | 3392764 | 3392946 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 42 | 331251 | 331442 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 43 | 5300670 | 5300852 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 44 | 1923737 | 1923925 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 45 | 26523 | 26696 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 46 | 3664766 | 3664963 | - | NZ_CP011937.1 | Bacillus velezensis |
| 47 | 294829 | 295026 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 48 | 2530997 | 2531176 | - | NZ_CP019699.1 | Novibacillus thermophilus |
| 49 | 2289012 | 2289194 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 50 | 647721 | 647894 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 51 | 637074 | 637247 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 52 | 601442 | 601615 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 53 | 1354558 | 1354731 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 54 | 624432 | 624611 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 55 | 1415200 | 1415370 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 56 | 2458598 | 2458789 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 57 | 2920714 | 2920881 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 58 | 1038804 | 1039013 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 59 | 771254 | 771442 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 60 | 767687 | 767887 | + | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 61 | 2289789 | 2289950 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 62 | 3014469 | 3014666 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 63 | 4896662 | 4896838 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 64 | 952337 | 952516 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 65 | 4430770 | 4430946 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 66 | 3156052 | 3156228 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 67 | 206966 | 207166 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 68 | 2054145 | 2054306 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 69 | 611313 | 611486 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 70 | 923455 | 923649 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 71 | 509682 | 509885 | + | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 72 | 2941231 | 2941422 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 73 | 2043971 | 2044144 | + | NZ_CP039710.1 | Thermoactinomyces vulgaris |
| 74 | 1422555 | 1422704 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 75 | 1811336 | 1811518 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 76 | 1222537 | 1222710 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 77 | 2685244 | 2685444 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 78 | 1832605 | 1832775 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 79 | 1779363 | 1779533 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 80 | 389538 | 389717 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 81 | 3917164 | 3917349 | - | NZ_CP031223.1 | Psychrobacillus glaciei |
| 82 | 4250928 | 4251125 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 83 | 2112911 | 2113087 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 84 | 1545494 | 1545661 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 85 | 4016797 | 4016997 | - | NZ_AP019400.1 | Cohnella abietis |
| 86 | 2249283 | 2249438 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 87 | 419356 | 419559 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 88 | 1746300 | 1746470 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 89 | 1911608 | 1911775 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 90 | 593027 | 593206 | - | NZ_LR134483.1 | Listeria grayi |
| 91 | 639228 | 639422 | + | NZ_LS483476.1 | Lederbergia lentus |
| 92 | 757767 | 757922 | + | NZ_LS483476.1 | Lederbergia lentus |
| 93 | 979971 | 980150 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 94 | 4473483 | 4473689 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 95 | 560438 | 560623 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 96 | 1376963 | 1377163 | - | NZ_CP013661.2 | Planococcus kocurii |
| 97 | 1218660 | 1218842 | - | NZ_CP013661.2 | Planococcus kocurii |
| 98 | 388411 | 388611 | + | NZ_CP019401.1 | Planococcus faecalis |
| 99 | 546715 | 546897 | + | NZ_CP019401.1 | Planococcus faecalis |
| 100 | 1553590 | 1553760 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 101 | 729853 | 730023 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 102 | 2390173 | 2390343 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 103 | 990093 | 990263 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 104 | 3943793 | 3943945 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 105 | 4190493 | 4190690 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 106 | 1908891 | 1909091 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 107 | 4039991 | 4040197 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 108 | 3923949 | 3924110 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 109 | 549718 | 549900 | + | NZ_CP059540.1 | Planococcus maritimus |
| 110 | 2823464 | 2823658 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 111 | 373322 | 373504 | + | NZ_CP016540.2 | Planococcus versutus |
| 112 | 3471561 | 3471716 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 113 | 54839 | 55024 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 114 | 710226 | 710438 | + | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 115 | 3189380 | 3189583 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 116 | 2264387 | 2264554 | - | NZ_CP034118.1 | Staphylospora marina |
| 117 | 4668083 | 4668286 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 118 | 1523014 | 1523226 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
| 119 | 3222797 | 3222976 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 120 | 625859 | 626071 | + | NZ_CP022046.2 | Mammaliicoccus sciuri |
| 121 | 4037956 | 4038114 | + | NZ_CP053352.1 | Winogradskyella helgolandensis |
| 122 | 547545 | 547727 | + | NZ_CP016538.2 | Planococcus maritimus |
| 123 | 2581976 | 2582152 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 124 | 1229891 | 1230055 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 125 | 2567849 | 2568022 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 126 | 1307662 | 1307844 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 127 | 1922210 | 1922407 | + | NZ_CP022378.1 | Capnocytophaga cynodegmi |
| 128 | 815118 | 815267 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 129 | 556814 | 556990 | - | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP040336.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00902.20 | 0.76 | 68 | 62 | same-strand | Sec-independent protein translocase protein (TatC) |
++ More..