Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | CP000879.1 |
Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
Left | 98391 |
Right | 98609 |
Strand | + |
Nucleotide Sequence | ATGAATTTGGGAATAAATTACGATAGAATATTAAATAAAGCGAAGTATAAATATGTAATTCCTATTATTGCAGCTAAAAGGGCTGAAACTCTAAAAAACTTAGATGAATTGAAAGGGATTACTGAGAAAAAAGACTACGTAAGCATCGCCTTAAAAGAATTAGAAAACGGTAAAATACAAGTCAAAAATTCAGCTTTATTAGATAGTTTAAGTAAATAG |
Sequence | MNLGINYDRILNKAKYKYVIPIIAAKRAETLKNLDELKGITEKKDYVSIALKELENGKIQVKNSALLDSLSK |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
Pubmed ID | |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | A9BEX2 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 98391 | 98609 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
2 | 100053 | 100244 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
3 | 240773 | 241000 | - | NZ_AP018712.1 | Tepiditoga spiralis |
4 | 102732 | 102959 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
5 | 336303 | 336530 | - | NC_011653.1 | Thermosipho africanus TCF52B |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00266.21 | 0.6 | 3 | 1940 | same-strand | Aminotransferase class-V |
2 | PF03755.15 | 1.0 | 5 | 960 | same-strand | YicC-like family, N-terminal region |
3 | PF08340.13 | 1.0 | 5 | 960 | same-strand | Domain of unknown function (DUF1732) |
4 | PF04025.14 | 1.0 | 5 | 628 | same-strand | Domain of unknown function (DUF370) |
5 | PF00625.23 | 1.0 | 5 | 2 | same-strand | Guanylate kinase |
6 | PF13238.8 | 1.0 | 5 | 2 | same-strand | AAA domain |