Result : A9BEX2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000879.1 |
| Organism | Petrotoga mobilis (strain DSM 10674 / SJ95) |
| Left | 98391 |
| Right | 98609 |
| Strand | + |
| Nucleotide Sequence | ATGAATTTGGGAATAAATTACGATAGAATATTAAATAAAGCGAAGTATAAATATGTAATTCCTATTATTGCAGCTAAAAGGGCTGAAACTCTAAAAAACTTAGATGAATTGAAAGGGATTACTGAGAAAAAAGACTACGTAAGCATCGCCTTAAAAGAATTAGAAAACGGTAAAATACAAGTCAAAAATTCAGCTTTATTAGATAGTTTAAGTAAATAG |
| Sequence | MNLGINYDRILNKAKYKYVIPIIAAKRAETLKNLDELKGITEKKDYVSIALKELENGKIQVKNSALLDSLSK |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A9BEX2 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 98391 | 98609 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 2 | 100053 | 100244 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 3 | 240773 | 241000 | - | NZ_AP018712.1 | Tepiditoga spiralis |
| 4 | 102732 | 102959 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 5 | 336303 | 336530 | - | NC_011653.1 | Thermosipho africanus TCF52B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010003.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00266.21 | 0.6 | 3 | 1940 | same-strand | Aminotransferase class-V |
| 2 | PF03755.15 | 1.0 | 5 | 960 | same-strand | YicC-like family, N-terminal region |
| 3 | PF08340.13 | 1.0 | 5 | 960 | same-strand | Domain of unknown function (DUF1732) |
| 4 | PF04025.14 | 1.0 | 5 | 628 | same-strand | Domain of unknown function (DUF370) |
| 5 | PF00625.23 | 1.0 | 5 | 2 | same-strand | Guanylate kinase |
| 6 | PF13238.8 | 1.0 | 5 | 2 | same-strand | AAA domain |
++ More..