Protein Information |
Information Type | Description |
---|---|
Protein name | UPF0457 protein BA_2525/GBAA_2525/BAS2348 |
NCBI Accession ID | AE016879.1 |
Organism | Bacillus anthracis |
Left | 2348268 |
Right | 2348468 |
Strand | - |
Nucleotide Sequence | TTGGCGGAGATTACCATTCCATTACGTGATGTAATTGAGGTTACTGAAGATGCTACCTATGCGGGTGTTGAAGTGACTAGTGCAATCCGTATTGGCACTGCATATGGAACAACGGATCGTATTTTAATCAAAACAGTAAAACAAAATTATGTATTATTTACAACAAATAAAGTTTCAATTTTAAATGCAATAAACGCTTAA |
Sequence | MAEITIPLRDVIEVTEDATYAGVEVTSAIRIGTAYGTTDRILIKTVKQNYVLFTTNKVSILNAINA |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 12721629 18952800 |
Domain | |
Functional Category | Others |
Uniprot ID | Q81QA7 |
ORF Length (Amino Acid) | 66 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2348392 | 2348592 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
2 | 3343959 | 3344129 | + | NZ_CP032365.1 | Bacillus wiedmannii |
3 | 3327486 | 3327686 | + | NZ_CP064875.1 | Bacillus toyonensis |
4 | 823599 | 823826 | + | NZ_CP059540.1 | Planococcus maritimus |
5 | 2736626 | 2736856 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
6 | 3544429 | 3544659 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02557.19 | 0.6 | 3 | 312 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
2 | PF02518.28 | 0.6 | 3 | 5128.5 | both-strands | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |