Result : Q81QA7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0457 protein BA_2525/GBAA_2525/BAS2348 |
| NCBI Accession ID | AE016879.1 |
| Organism | Bacillus anthracis |
| Left | 2348268 |
| Right | 2348468 |
| Strand | - |
| Nucleotide Sequence | TTGGCGGAGATTACCATTCCATTACGTGATGTAATTGAGGTTACTGAAGATGCTACCTATGCGGGTGTTGAAGTGACTAGTGCAATCCGTATTGGCACTGCATATGGAACAACGGATCGTATTTTAATCAAAACAGTAAAACAAAATTATGTATTATTTACAACAAATAAAGTTTCAATTTTAAATGCAATAAACGCTTAA |
| Sequence | MAEITIPLRDVIEVTEDATYAGVEVTSAIRIGTAYGTTDRILIKTVKQNYVLFTTNKVSILNAINA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12721629 18952800 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q81QA7 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2348392 | 2348592 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 2 | 3343959 | 3344129 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 3 | 3327486 | 3327686 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 823599 | 823826 | + | NZ_CP059540.1 | Planococcus maritimus |
| 5 | 2736626 | 2736856 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 6 | 3544429 | 3544659 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032365.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02557.19 | 0.6 | 3 | 312 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
| 2 | PF02518.28 | 0.6 | 3 | 5128.5 | both-strands | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
++ More..