Result : Q81DD0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 2380112 |
| Right | 2380288 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAAGTCAATGTGCAAAAGTCTTCGTTTTTTAAAGAAAAAAAAGAAGAATCCAATACAGATTTCTCTCTTGTGAAAGGTGCATTAACGGAGAATATAAATCGGTTAGAGAAACTAATGAATAATAGTAGTTCAAAATATATACAGGTGAAAAGAACAAAAGAAAATGCATAG |
| Sequence | MAEVNVQKSSFFKEKKEESNTDFSLVKGALTENINRLEKLMNNSSSKYIQVKRTKENA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that binds toxin SpoIISA and neutralizes its toxic activity. Upon coexpression with SpoIISA in E.coli normal growth is restored. {ECO:0000269|Pubmed:18096016}. |
| Pubmed ID | 12721630 18096016 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q81DD0 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2344744 | 2344920 | + | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 2362398 | 2362574 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 3 | 2414048 | 2414224 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 4 | 2751341 | 2751517 | - | NZ_CP040336.1 | Bacillus luti |
| 5 | 2318904 | 2319080 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 2317558 | 2317734 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 7 | 1907045 | 1907221 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011725.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02776.20 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 2 | PF00205.24 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, central domain |
| 3 | PF02775.23 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 4 | PF12802.9 | 1.0 | 6 | 2147.0 | same-strand | MarR family |
| 5 | PF01047.24 | 1.0 | 6 | 2147.0 | same-strand | MarR family |
| 6 | PF13412.8 | 0.83 | 5 | 2148 | same-strand | Winged helix-turn-helix DNA-binding |
| 7 | PF13463.8 | 1.0 | 6 | 2147.0 | same-strand | Winged helix DNA-binding domain |
| 8 | PF14171.8 | 0.83 | 5 | 314.5 | same-strand | Toxin SpoIISA, type II toxin-antitoxin system |
| 9 | PF01546.30 | 1.0 | 6 | 620 | same-strand | Peptidase family M20/M25/M40 |
| 10 | PF07687.16 | 1.0 | 6 | 620 | same-strand | Peptidase dimerisation domain |
++ More..