Protein Information |
Information Type | Description |
---|---|
Protein name | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) |
NCBI Accession ID | AE016877.1 |
Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
Left | 2380112 |
Right | 2380288 |
Strand | + |
Nucleotide Sequence | ATGGCTGAAGTCAATGTGCAAAAGTCTTCGTTTTTTAAAGAAAAAAAAGAAGAATCCAATACAGATTTCTCTCTTGTGAAAGGTGCATTAACGGAGAATATAAATCGGTTAGAGAAACTAATGAATAATAGTAGTTCAAAATATATACAGGTGAAAAGAACAAAAGAAAATGCATAG |
Sequence | MAEVNVQKSSFFKEKKEESNTDFSLVKGALTENINRLEKLMNNSSSKYIQVKRTKENA |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that binds toxin SpoIISA and neutralizes its toxic activity. Upon coexpression with SpoIISA in E.coli normal growth is restored. {ECO:0000269|Pubmed:18096016}. |
Pubmed ID | 12721630 18096016 |
Domain | |
Functional Category | Antitoxin_type_2 |
Uniprot ID | Q81DD0 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2344744 | 2344920 | + | NC_011725.1 | Bacillus cereus B4264 |
2 | 2362398 | 2362574 | + | NZ_CP064875.1 | Bacillus toyonensis |
3 | 2414048 | 2414224 | + | NZ_CP032365.1 | Bacillus wiedmannii |
4 | 2751341 | 2751517 | - | NZ_CP040336.1 | Bacillus luti |
5 | 2318904 | 2319080 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
6 | 2317558 | 2317734 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
7 | 1907045 | 1907221 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02776.20 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
2 | PF00205.24 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, central domain |
3 | PF02775.23 | 0.83 | 5 | 2755 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
4 | PF12802.9 | 1.0 | 6 | 2147.0 | same-strand | MarR family |
5 | PF01047.24 | 1.0 | 6 | 2147.0 | same-strand | MarR family |
6 | PF13412.8 | 0.83 | 5 | 2148 | same-strand | Winged helix-turn-helix DNA-binding |
7 | PF13463.8 | 1.0 | 6 | 2147.0 | same-strand | Winged helix DNA-binding domain |
8 | PF14171.8 | 0.83 | 5 | 314.5 | same-strand | Toxin SpoIISA, type II toxin-antitoxin system |
9 | PF01546.30 | 1.0 | 6 | 620 | same-strand | Peptidase family M20/M25/M40 |
10 | PF07687.16 | 1.0 | 6 | 620 | same-strand | Peptidase dimerisation domain |