Result : Q81AD9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0337 protein BC_3635 |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 3606406 |
| Right | 3606618 |
| Strand | + |
| Nucleotide Sequence | ATGACTAAACATGATCATGGTTTAAAAGAAAAAGTAGAAGGTACCATTGATAAGGTAAAAGGTGAAGTCAAAGAAGTTGTTGGGAAAGTAACTGACAATAAGAAATTACAAGCTGAAGGAAAATGGGATAAGGTGAAAGGCACTGCTAAAGATACAGTTGGTAATGTGAAAGAAAAAGTACATGAATATAAGGAACATAAGAAAGAAAAATAA |
| Sequence | MTKHDHGLKEKVEGTIDKVKGEVKEVVGKVTDNKKLQAEGKWDKVKGTAKDTVGNVKEKVHEYKEHKKEK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22912. Profile Description: CsbD-like. hypothetical protein; Provisional |
| Pubmed ID | 12721630 |
| Domain | CDD:419889 |
| Functional Category | Others |
| Uniprot ID | Q81AD9 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3658283 | 3658495 | + | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 3577376 | 3577588 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 3 | 3395364 | 3395576 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 984190 | 984390 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 5 | 1746679 | 1746891 | - | NZ_CP040336.1 | Bacillus luti |
| 6 | 3447987 | 3448199 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 7 | 720397 | 720597 | + | NZ_LS483476.1 | Lederbergia lentus |
| 8 | 31636 | 31824 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 9 | 1761121 | 1761297 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 10 | 2230211 | 2230402 | + | NZ_CP059540.1 | Planococcus maritimus |
| 11 | 2187703 | 2187894 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 12 | 2207887 | 2208078 | + | NZ_CP016538.2 | Planococcus maritimus |
| 13 | 265410 | 265595 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 14 | 2754723 | 2754905 | + | NZ_CP026100.1 | Caulobacter flavus |
| 15 | 65849 | 66028 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 16 | 4046138 | 4046326 | + | NZ_CP031093.1 | Hydrocarboniclastica marina |
++ More..