Result : Q813Q5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein BC_1827 |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 1783931 |
| Right | 1784161 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAACATTTTATTCCGTATTAACGAATTGTCAAAAAAAGAAAAAGCAACTGGATTAACAGTTGATGAAAAACAAGAACAACAAATGTTACGTCAAAACTATACAGAAACATTTCGTGGAAGCCTAGATTCCATTTTATTAAACACAAAAATTGTTGATCAAAATGGTCTTAACGTTACACCTGCTGCATTACAAGATGCTCAAATACGTTTAAAATTAAGCAAATGA |
| Sequence | MKNILFRINELSKKEKATGLTVDEKQEQQMLRQNYTETFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 12721630 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | Q813Q5 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 34
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1808055 | 1808285 | - | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 1781019 | 1781249 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 3 | 1807659 | 1807889 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 4 | 1746271 | 1746501 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 3319056 | 3319286 | + | NZ_CP040336.1 | Bacillus luti |
| 6 | 190559 | 190798 | - | NZ_CP014161.1 | Aerococcus urinae |
| 7 | 2074438 | 2074689 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 8 | 2265683 | 2265910 | + | NZ_CP034437.1 | Paenibacillus albus |
| 9 | 2216602 | 2216844 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 10 | 777328 | 777558 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 11 | 1673267 | 1673464 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 12 | 4023749 | 4023976 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 13 | 3163002 | 3163217 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 14 | 2515902 | 2516129 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 15 | 5423220 | 5423447 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 16 | 5230929 | 5231135 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 17 | 1838359 | 1838586 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 18 | 4737166 | 4737393 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 19 | 2203257 | 2203490 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 20 | 3070188 | 3070418 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 21 | 3546453 | 3546683 | - | NZ_CP043404.1 | Bacillus safensis |
| 22 | 4521481 | 4521714 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 23 | 1816353 | 1816589 | + | NZ_CP027770.1 | Staphylococcus felis |
| 24 | 3856031 | 3856261 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 25 | 4787194 | 4787391 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 655671 | 655904 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 27 | 196118 | 196339 | - | NZ_CP016809.1 | Paenibacillus ihbetae |
| 28 | 2169848 | 2170090 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 29 | 1769111 | 1769341 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 30 | 1383380 | 1383577 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 31 | 2626037 | 2626222 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
| 32 | 2449028 | 2449240 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 33 | 2664945 | 2665175 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
| 34 | 1123269 | 1123505 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
++ More..