Result : Q813M3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein BC_2253 |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 2202781 |
| Right | 2202996 |
| Strand | + |
| Nucleotide Sequence | TTGAAAAAGACATTTTACCATTATATGATGAAGCATCGTGCAGCTTTATTTAGAAATGAAATTTCAGATTTAGCAGAGGCGATGTATGATGATTTAAGTTTTCCGAAGCAATCTGAAGACTATGATGAAATTAGTTCATACTTAGAGTTGAGCGGAATGCTAGAAAGTATGTCTATATTTGATGAAGCCTGGGATTTATACATACAAGATAGATAA |
| Sequence | MKKTFYHYMMKHRAALFRNEISDLAEAMYDDLSFPKQSEDYDEISSYLELSGMLESMSIFDEAWDLYIQDR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 12721630 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q813M3 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2188431 | 2188646 | + | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 2935236 | 2935451 | - | NZ_CP040336.1 | Bacillus luti |
| 3 | 2149529 | 2149744 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 2190218 | 2190433 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 5 | 2218554 | 2218769 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 6 | 1789756 | 1789971 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 2229384 | 2229605 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 8 | 1961368 | 1961598 | + | NZ_CP012024.1 | Bacillus smithii |
| 9 | 3804209 | 3804430 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 10 | 2956420 | 2956647 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 11 | 3799211 | 3799402 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 12 | 2027812 | 2028036 | + | NZ_LS483476.1 | Lederbergia lentus |
| 13 | 1710952 | 1711155 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 14 | 1910845 | 1911069 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 15 | 2687291 | 2687494 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 2247170 | 2247367 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 17 | 2348354 | 2348551 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 18 | 1482318 | 1482536 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 1060553 | 1060777 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 20 | 2454764 | 2454961 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 21 | 3073106 | 3073345 | - | NZ_CP053989.1 | Niallia circulans |
| 22 | 2081787 | 2081987 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 23 | 2138868 | 2139068 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 24 | 2228869 | 2229069 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 25 | 2151675 | 2151875 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 26 | 3850677 | 3850895 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 27 | 2584488 | 2584706 | - | NZ_CP049887.1 | Vagococcus hydrophili |
| 28 | 307545 | 307748 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 29 | 1851955 | 1852155 | + | NZ_CP011937.1 | Bacillus velezensis |
| 30 | 281168 | 281362 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 31 | 2098645 | 2098845 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 32 | 171041 | 171238 | - | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 33 | 3310907 | 3311107 | + | NZ_CP043404.1 | Bacillus safensis |
| 34 | 2071975 | 2072172 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 35 | 2142544 | 2142744 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 36 | 3401692 | 3401892 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 37 | 1977451 | 1977651 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 38 | 4986136 | 4986354 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 39 | 3984518 | 3984718 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 40 | 658072 | 658302 | - | NZ_CP031513.1 | Bombilactobacillus bombi |
| 41 | 671550 | 671744 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011725.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12544.10 | 0.66 | 27 | 386 | same-strand | Lysine-2,3-aminomutase |
| 2 | PF04055.23 | 0.68 | 28 | 386.0 | same-strand | Radical SAM superfamily |
| 3 | PF14122.8 | 0.66 | 27 | 104 | same-strand | YokU-like protein, putative antitoxin |
| 4 | PF14162.8 | 0.8 | 33 | 1098 | same-strand | YozD-like protein |
++ More..