Result : Q7WY68
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YozQ |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2029020 |
| Right | 2029313 |
| Strand | + |
| Nucleotide Sequence | GTGACTCAAAAAAACGGTGCAGACAGACCTGATGATTATAAAAGATTTTCTTCATTAGACAAGGAATATGATTTTCAGCAATCTATACGCAGCAATACTGAGACAGAAAGTGTAAACACTGAAACACAAACTCATAACAAAGAAAACAAAAATGACACAACAGATGTTGCCGGGAAATACTTTGAGCCCTCAGATTATAAAGGAAGCACGCAATTAGAAAAAGGATTGGCTGAAACTCATGAACAGGTCAGCGATGACTATTTTGAAGGGACAATCGATCAAAATTTGGACTAG |
| Sequence | MTQKNGADRPDDYKRFSSLDKEYDFQQSIRSNTETESVNTETQTHNKENKNDTTDVAGKYFEPSDYKGSTQLEKGLAETHEQVSDDYFEGTIDQNLD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13217. Profile Description: Protein of unknown function (DUF4025). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved EGT sequence motif. |
| Pubmed ID | 9384377 |
| Domain | CDD:315803 |
| Functional Category | Others |
| Uniprot ID | Q7WY68 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2029020 | 2029313 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1949519 | 1949812 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2046236 | 2046526 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2034907 | 2035200 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2146320 | 2146613 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2188597 | 2188884 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 7 | 2285423 | 2285710 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 8 | 2068802 | 2069095 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 1281260 | 1281553 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 712659 | 712946 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..