Protein Information |
Information Type | Description |
---|---|
Protein name | Small, acid-soluble spore protein L (SASP L) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2310859 |
Right | 2310987 |
Strand | + |
Nucleotide Sequence | ATGAAAAAGAAAGATAAAGGCCGGCTGACCGGCGGTGTTACTCCGCAAGGCGACCTGGAAGGCAATACACATAATGACCCTAAAACAGAGCTTGAGGAGAGAGCAAAAAAAAGCAATACAAAACGCTAG |
Sequence | MKKKDKGRLTGGVTPQGDLEGNTHNDPKTELEERAKKSNTKR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of TIGR03093. Profile Description: small, acid-soluble spore protein L. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspL. [Cellular processes, Sporulation and germination] |
Pubmed ID | 9384377 9852018 10333516 |
Domain | CDD:132137 |
Functional Category | Others |
Uniprot ID | Q7WY66 |
ORF Length (Amino Acid) | 42 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2310859 | 2310987 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2180131 | 2180259 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 2187923 | 2188051 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 3945673 | 3945801 | - | NZ_CP029364.1 | Bacillus halotolerans |
5 | 2108763 | 2108891 | + | NZ_CP051464.1 | Bacillus mojavensis |
6 | 2119986 | 2120114 | + | NZ_CP013984.1 | Bacillus inaquosorum |
7 | 2266468 | 2266596 | + | NZ_CP033052.1 | Bacillus vallismortis |
8 | 2152673 | 2152801 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 1803198 | 1803326 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 2493346 | 2493483 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 2387317 | 2387463 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
12 | 2285967 | 2286113 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
13 | 3275531 | 3275656 | - | NZ_CP043404.1 | Bacillus safensis |
14 | 279362 | 279466 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
15 | 3366525 | 3366650 | - | NZ_CP017786.1 | Bacillus xiamenensis |
16 | 2297639 | 2297779 | - | NZ_CP024035.1 | Priestia aryabhattai |
17 | 3696731 | 3696865 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
18 | 749905 | 750009 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
19 | 263792 | 263932 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
20 | 799608 | 799745 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF10819.10 | 0.6 | 12 | 2095.0 | same-strand | Protein of unknown function (DUF2564) |
2 | PF10782.11 | 0.75 | 15 | 1885 | opposite-strand | Zinc-finger |
3 | PF13456.8 | 0.75 | 15 | 1110.0 | both-strands | Reverse transcriptase-like |
4 | PF02592.17 | 0.7 | 14 | 440.0 | same-strand | Putative vitamin uptake transporter |
5 | PF00075.26 | 0.75 | 15 | 44.0 | same-strand | RNase H |
6 | PF02739.18 | 0.75 | 15 | 9 | opposite-strand | 5'-3' exonuclease, N-terminal resolvase-like domain |
7 | PF01367.22 | 0.75 | 15 | 9 | opposite-strand | 5'-3' exonuclease, C-terminal SAM fold |
8 | PF10752.11 | 0.7 | 14 | 1217.5 | opposite-strand | Protein of unknown function (DUF2533) |
9 | PF00350.25 | 0.7 | 14 | 1542.0 | opposite-strand | Dynamin family |
10 | PF01926.25 | 0.75 | 15 | 1542 | opposite-strand | 50S ribosome-binding GTPase |