Protein Information |
Information Type | Description |
---|---|
Protein name | Membrane protein insertion and folding monitor (Sensor of SpoIIIJ activity) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2483586 |
Right | 2483873 |
Strand | + |
Nucleotide Sequence | ATGACAATGTTTGTGGAATCGATAAATGACGTTTTATTCTTAGTCGATTTTTTCACAATTATTCTTCCTGCTCTAACGGCAATCGGGATTGCATTCCTCTTACGGGAGTGCCGTGCGGGCGAGCAATGGAAATCAAAACGAACAGATGAACATCAGACGGTCTTTCACATTAACCGAACAGACTTTCTTATTATTATATATCATCGCATTACAACTTGGATACGTAAAGTCTTCCGCATGAATTCGCCTGTGAACGATGAGGAAGACGCCGGTTCTCTTCTTTTATAA |
Sequence | MTMFVESINDVLFLVDFFTIILPALTAIGIAFLLRECRAGEQWKSKRTDEHQTVFHINRTDFLIIIYHRITTWIRKVFRMNSPVNDEEDAGSLLL |
Source of smORF | Swiss-Prot |
Function | Sensor protein that upregulates translation of the secondary membrane protein insertase (MisCB/YqjG) when activity of the primary membrane protein insertase (MisCA/SpoIIIJ) is limited. Acts as a ribosome-nascent chain complex. When the primary membrane protein insertase activity or level is reduced, the membrane insertion of MifM is impaired, which induces arrest of MifM translation and unfolding of the mRNA hairpin. Unfolding leads to translation of the downstream gene, which encodes the secondary membrane protein insertase MisCB/YqjG. Translation arrest of MifM is mediated by interaction of its C-terminal domain with the ribosomal polypeptide exit tunnel. Undergoes multisite stalling, which may allow a sufficient duration of ribosomal stalling and consequently sufficient levels of MisCB/YqjG. {ECO:0000269|Pubmed:19779460, ECO:0000269|Pubmed:21383133, ECO:0000269|Pubmed:22864117}. |
Pubmed ID | 9384377 19779460 21383133 22864117 |
Domain | |
Functional Category | Others |
Uniprot ID | Q7WY64 |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2483586 | 2483873 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2446039 | 2446326 | + | NZ_CP033052.1 | Bacillus vallismortis |
3 | 2280531 | 2280818 | + | NZ_CP051464.1 | Bacillus mojavensis |
4 | 2343229 | 2343504 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 2356495 | 2356776 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 3773578 | 3773853 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 2357710 | 2357985 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
8 | 1563915 | 1564196 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 2435769 | 2436050 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 2761860 | 2762147 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 2488639 | 2488926 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 2642016 | 2642303 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3187020 | 3187301 | - | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 2188247 | 2188528 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 3098282 | 3098563 | - | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02781.18 | 0.6 | 9 | 2961 | same-strand | Glucose-6-phosphate dehydrogenase, C-terminal domain |
2 | PF00479.24 | 0.6 | 9 | 2961 | same-strand | Glucose-6-phosphate dehydrogenase, NAD binding domain |
3 | PF00393.21 | 1.0 | 15 | 1429 | opposite-strand | 6-phosphogluconate dehydrogenase, C-terminal domain |
4 | PF03446.17 | 1.0 | 15 | 1429 | opposite-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
5 | PF00817.22 | 1.0 | 15 | 81 | opposite-strand | impB/mucB/samB family |
6 | PF11799.10 | 1.0 | 15 | 81 | opposite-strand | impB/mucB/samB family C-terminal domain |
7 | PF11798.10 | 1.0 | 15 | 81 | opposite-strand | IMS family HHH motif |
8 | PF02096.22 | 1.0 | 15 | 30 | same-strand | 60Kd inner membrane protein |
9 | PF01546.30 | 1.0 | 15 | 1567 | opposite-strand | Peptidase family M20/M25/M40 |
10 | PF07687.16 | 1.0 | 15 | 1567 | opposite-strand | Peptidase dimerisation domain |
11 | PF01039.24 | 0.93 | 14 | 2646.5 | opposite-strand | Carboxyl transferase domain |
12 | PF13669.8 | 0.73 | 11 | 4412 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
13 | PF00903.27 | 0.67 | 10 | 4413.0 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |