Result : Q7WY63
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein AntE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2602979 |
| Right | 2603275 |
| Strand | + |
| Nucleotide Sequence | GTGCCTCAGCCATTTTTTGTTCTCCAGAAGACTCTGGCCGGGCTCCGGAATGGACTGTTATATCATCTGGAAAATCAATTTGGTATTTGTCAGCAAGGTGAGAAACCGACTCGGCAAAAGAATAGCCTTCCATCTGCCTTAAAAAAGAGAAAACATTGCCGCCCGCTCCGCAGCCAAAGCAATGAAAAATCTGTTTGTCGGGCGATACGGAAAACGAAGGTGTGCTTTCTCCATGAAAAGGACAGAGTCCAAAGTAGTTTCGGCCTTGCTTCTTTAATTGAACATAATCACCTATGA |
| Sequence | MPQPFFVLQKTLAGLRNGLLYHLENQFGICQQGEKPTRQKNSLPSALKKRKHCRPLRSQSNEKSVCRAIRKTKVCFLHEKDRVQSSFGLASLIEHNHL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 9864351 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q7WY63 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2602979 | 2603275 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2476365 | 2476706 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2461927 | 2462268 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2475034 | 2475375 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3654639 | 3654980 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2399537 | 2399878 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01784.20 | 0.83 | 5 | 4317 | opposite-strand | NIF3 (NGG1p interacting factor 3) |
| 2 | PF04816.14 | 1.0 | 6 | 3640.5 | opposite-strand | tRNA (adenine(22)-N(1))-methyltransferase |
| 3 | PF12847.9 | 1.0 | 6 | 3640.5 | opposite-strand | Methyltransferase domain |
| 4 | PF13442.8 | 1.0 | 6 | 3051.5 | opposite-strand | Cytochrome C oxidase, cbb3-type, subunit III |
| 5 | PF04539.18 | 1.0 | 6 | 1607.5 | opposite-strand | Sigma-70 region 3 |
| 6 | PF04545.18 | 1.0 | 6 | 1607.5 | opposite-strand | Sigma-70, region 4 |
| 7 | PF04542.16 | 1.0 | 6 | 1607.5 | opposite-strand | Sigma-70 region 2 |
| 8 | PF03979.16 | 1.0 | 6 | 1607.5 | opposite-strand | Sigma-70 factor, region 1.1 |
| 9 | PF00140.22 | 1.0 | 6 | 1607.5 | opposite-strand | Sigma-70 factor, region 1.2 |
| 10 | PF08275.13 | 1.0 | 6 | -341.0 | opposite-strand | DNA primase catalytic core, N-terminal domain |
| 11 | PF01807.22 | 1.0 | 6 | -341.0 | opposite-strand | CHC2 zinc finger |
| 12 | PF13155.8 | 1.0 | 6 | -341.0 | opposite-strand | Toprim-like |
| 13 | PF13662.8 | 1.0 | 6 | -341.0 | opposite-strand | Toprim domain |
| 14 | PF10410.11 | 1.0 | 6 | -341.0 | opposite-strand | DnaB-helicase binding domain of primase |
| 15 | PF13362.8 | 1.0 | 6 | -341.0 | opposite-strand | Toprim domain |
| 16 | PF01751.24 | 1.0 | 6 | -341.0 | opposite-strand | Toprim domain |
| 17 | PF02639.16 | 1.0 | 6 | 98.0 | opposite-strand | Uncharacterized BCR, YaiI/YqxD family COG1671 |
| 18 | PF03618.16 | 1.0 | 6 | 846.0 | opposite-strand | Kinase/pyrophosphorylase |
| 19 | PF00571.30 | 1.0 | 6 | 1684.0 | opposite-strand | CBS domain |
| 20 | PF08279.14 | 1.0 | 6 | 1684.0 | opposite-strand | HTH domain |
| 21 | PF01047.24 | 1.0 | 6 | 1684.0 | opposite-strand | MarR family |
| 22 | PF02092.19 | 1.0 | 6 | 2456.0 | opposite-strand | Glycyl-tRNA synthetase beta subunit |
| 23 | PF02091.17 | 0.83 | 5 | 4488 | opposite-strand | Glycyl-tRNA synthetase alpha subunit |
++ More..