Result : Q7WY62
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sporulation inhibitor sda (Histidine kinase KinA inhibitor) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2647456 |
| Right | 2647614 |
| Strand | + |
| Nucleotide Sequence | ATTAATTGGGTTCCTAGCATGAGAAAACTGTCTGATGAATTACTAATAGAATCTTATTTCAAAGCCACCGAAATGAATTTAAACCGTGACTTTATTGAGTTAATTGAAAACGAAATAAAAAGAAGATCGCTCGGACATATTATTTCCGTATCTTCTTAA |
| Sequence | MNWVPSMRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS |
| Source of smORF | Swiss-Prot |
| Function | Mediates a developmental checkpoint inhibiting initiation of sporulation (by preventing phosphorylation of spo0A) in response to defects in the replication initiation machinery. Inhibits autophosphorylation of the histidine protein kinase KinA, forming a molecular barricade that prevents productive interaction between the ATP-binding site in the catalytic domain and the phosphorylatable His in the phosphotransfer domain of KinA. Probably also inhibits the activity of KinB, but has relatively little effect on KinC. Has at least one target in vivo in addition to KinA as sda does not require KinA to inhibit sporulation. {ECO:0000269|Pubmed:11207367, ECO:0000269|Pubmed:15023339}. |
| Pubmed ID | 9384377 11207367 15023339 |
| Domain | CDD:370219 |
| Functional Category | Others |
| Uniprot ID | Q7WY62 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 62
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2647474 | 2647614 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2506461 | 2506601 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2520899 | 2521039 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2519571 | 2519711 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 2615830 | 2615970 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3610297 | 3610428 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2444095 | 2444226 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2594344 | 2594484 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1405461 | 1405601 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 2655898 | 2656038 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2816946 | 2817086 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3033209 | 3033349 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 2342112 | 2342252 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 2944901 | 2945041 | - | NZ_CP043404.1 | Bacillus safensis |
| 15 | 2930447 | 2930587 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 16 | 1271940 | 1272080 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 3838900 | 3839040 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 2544240 | 2544371 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 19 | 1745384 | 1745515 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 20 | 3393144 | 3393275 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 21 | 3153889 | 3154026 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 22 | 3395347 | 3395487 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 23 | 1377523 | 1377654 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 24 | 2597849 | 2597989 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 25 | 3466605 | 3466745 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 26 | 3441807 | 3441947 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 27 | 735619 | 735759 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 28 | 3334493 | 3334633 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 29 | 1583179 | 1583319 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 30 | 808408 | 808557 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 31 | 3494744 | 3494884 | + | NZ_CP053989.1 | Niallia circulans |
| 32 | 2161414 | 2161554 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 33 | 1414156 | 1414296 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 34 | 4344908 | 4345048 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 35 | 3435669 | 3435809 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 36 | 2079513 | 2079653 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 37 | 4397044 | 4397184 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 38 | 763107 | 763247 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 39 | 3825377 | 3825517 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 40 | 2312651 | 2312791 | + | NZ_CP012024.1 | Bacillus smithii |
| 41 | 1650263 | 1650421 | - | NZ_LS483476.1 | Lederbergia lentus |
| 42 | 4022596 | 4022736 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 43 | 1986131 | 1986271 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 44 | 1819020 | 1819160 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 45 | 1148601 | 1148741 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 46 | 2328338 | 2328481 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 47 | 1072482 | 1072643 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 48 | 2269410 | 2269556 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 49 | 1947825 | 1947965 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 50 | 1409178 | 1409318 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 51 | 2857592 | 2857732 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 52 | 1131109 | 1131264 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 53 | 2860745 | 2860906 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 54 | 2016011 | 2016151 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 55 | 1889932 | 1890084 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 56 | 4184140 | 4184280 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 57 | 3416905 | 3417051 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 58 | 1761141 | 1761299 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 59 | 2073051 | 2073212 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 60 | 4357638 | 4357778 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 61 | 1760863 | 1760991 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 62 | 5076066 | 5076218 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01467.28 | 0.81 | 50 | 3165.0 | opposite-strand | Cytidylyltransferase-like |
| 2 | PF01985.23 | 0.9 | 56 | 2846.0 | opposite-strand | CRS1 / YhbY (CRM) domain |
| 3 | PF08501.13 | 0.9 | 56 | 2011.0 | opposite-strand | Shikimate dehydrogenase substrate binding domain |
| 4 | PF18317.3 | 0.87 | 54 | 2010.0 | opposite-strand | Shikimate 5'-dehydrogenase C-terminal domain |
| 5 | PF09419.12 | 0.68 | 42 | 374.5 | opposite-strand | Mitochondrial PGP phosphatase |
++ More..