Result : Q7WY58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein J (SASP J) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3421465 |
| Right | 3421605 |
| Strand | - |
| Nucleotide Sequence | ATGGGTTTCTTTAATAAAGATAAAGGAAAACGTTCCGAAAAAGAAAAAAACGTAATCCAAGGAGCTCTTGAAGATGCTGGTTCAGCTCTAAAAGATGATCCGCTTCAAGAAGCTGTGCAAAAAAAGAAAAATAATCGATAA |
| Sequence | MGFFNKDKGKRSEKEKNVIQGALEDAGSALKDDPLQEAVQKKKNNR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl27855. Profile Description: Small spore protein J (Spore_SspJ). New small, acid-soluble proteins unique to spores of Bacillus subtilis [Cellular processes, Sporulation and germination] |
| Pubmed ID | 9384377 9852018 |
| Domain | CDD:332676 |
| Functional Category | Others |
| Uniprot ID | Q7WY58 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3229792 | 3229932 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 3421465 | 3421605 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 3290052 | 3290192 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2835487 | 2835627 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3206196 | 3206336 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3281311 | 3281451 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3234431 | 3234568 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 766882 | 767022 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3250707 | 3250847 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3776860 | 3777003 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3593149 | 3593289 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3366254 | 3366394 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2387121 | 2387264 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 3021614 | 3021757 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2286984 | 2287127 | + | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01032.20 | 0.93 | 14 | 3323.0 | same-strand | FecCD transport family |
| 2 | PF01497.20 | 0.73 | 11 | 2143 | opposite-strand | Periplasmic binding protein |
| 3 | PF13520.8 | 1.0 | 15 | 414 | same-strand | Amino acid permease |
| 4 | PF00324.23 | 1.0 | 15 | 414 | same-strand | Amino acid permease |
| 5 | PF04307.16 | 0.93 | 14 | 176.5 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 6 | PF00884.25 | 1.0 | 15 | 751 | opposite-strand | Sulfatase |
| 7 | PF12727.9 | 0.6 | 9 | 2629 | same-strand | PBP superfamily domain |
| 8 | PF12728.9 | 0.6 | 9 | 2629 | same-strand | Helix-turn-helix domain |
| 9 | PF13531.8 | 0.8 | 12 | 3662.5 | opposite-strand | Bacterial extracellular solute-binding protein |
| 10 | PF01547.27 | 0.67 | 10 | 3665.5 | opposite-strand | Bacterial extracellular solute-binding protein |
| 11 | PF00528.24 | 0.8 | 12 | 4428.5 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
| 12 | PF00005.29 | 0.6 | 9 | 5236 | same-strand | ABC transporter |
++ More..