Result : Q7WY57
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriocin-like protein SboX |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3836146 |
| Right | 3836298 |
| Strand | + |
| Nucleotide Sequence | TTGAAATTGCCGGTGCAACAGGTCTATTCGGTCTATGGGGGTAAGGATCTCCCAAAAGGGCATAGTCATTCTACTATGCCCTTTTTAAGTAAATTACAATTTTTAACTAAAATCTACCTCTTGGATATACATACACAACCGTTTTTCATTTGA |
| Sequence | MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 10809709 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q7WY57 |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3836146 | 3836298 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3667219 | 3667371 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00027.31 | 1.0 | 2 | 3917.5 | opposite-strand | Cyclic nucleotide-binding domain |
| 2 | PF00325.22 | 1.0 | 2 | 3917.5 | opposite-strand | Bacterial regulatory proteins, crp family |
| 3 | PF13545.8 | 1.0 | 2 | 3917.5 | opposite-strand | Crp-like helix-turn-helix domain |
| 4 | PF07690.18 | 1.0 | 2 | 2630.5 | opposite-strand | Major Facilitator Superfamily |
| 5 | PF05746.17 | 1.0 | 2 | 825.5 | opposite-strand | DALR anticodon binding domain |
| 6 | PF00750.21 | 1.0 | 2 | 825.5 | opposite-strand | tRNA synthetases class I (R) |
| 7 | PF03485.18 | 1.0 | 2 | 825.5 | opposite-strand | Arginyl tRNA synthetase N terminal domain |
| 8 | PF09148.12 | 1.0 | 2 | 400.5 | opposite-strand | Domain of unknown function (DUF1934) |
| 9 | PF11420.10 | 1.0 | 2 | -43.0 | same-strand | Bacteriocin subtilosin A |
| 10 | PF04055.23 | 1.0 | 2 | 25.0 | same-strand | Radical SAM superfamily |
| 11 | PF13186.8 | 1.0 | 2 | 25.0 | same-strand | Iron-sulfur cluster-binding domain |
| 12 | PF05402.14 | 1.0 | 2 | 25.0 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 13 | PF00005.29 | 1.0 | 2 | 1542.0 | same-strand | ABC transporter |
++ More..