Protein Information |
Information Type | Description |
---|---|
Protein name | Bacteriocin-like protein SboX |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3836146 |
Right | 3836298 |
Strand | + |
Nucleotide Sequence | TTGAAATTGCCGGTGCAACAGGTCTATTCGGTCTATGGGGGTAAGGATCTCCCAAAAGGGCATAGTCATTCTACTATGCCCTTTTTAAGTAAATTACAATTTTTAACTAAAATCTACCTCTTGGATATACATACACAACCGTTTTTCATTTGA |
Sequence | MKLPVQQVYSVYGGKDLPKGHSHSTMPFLSKLQFLTKIYLLDIHTQPFFI |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 10809709 |
Domain | |
Functional Category | Others |
Uniprot ID | Q7WY57 |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3836146 | 3836298 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3667219 | 3667371 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00027.31 | 1.0 | 2 | 3917.5 | opposite-strand | Cyclic nucleotide-binding domain |
2 | PF00325.22 | 1.0 | 2 | 3917.5 | opposite-strand | Bacterial regulatory proteins, crp family |
3 | PF13545.8 | 1.0 | 2 | 3917.5 | opposite-strand | Crp-like helix-turn-helix domain |
4 | PF07690.18 | 1.0 | 2 | 2630.5 | opposite-strand | Major Facilitator Superfamily |
5 | PF05746.17 | 1.0 | 2 | 825.5 | opposite-strand | DALR anticodon binding domain |
6 | PF00750.21 | 1.0 | 2 | 825.5 | opposite-strand | tRNA synthetases class I (R) |
7 | PF03485.18 | 1.0 | 2 | 825.5 | opposite-strand | Arginyl tRNA synthetase N terminal domain |
8 | PF09148.12 | 1.0 | 2 | 400.5 | opposite-strand | Domain of unknown function (DUF1934) |
9 | PF11420.10 | 1.0 | 2 | -43.0 | same-strand | Bacteriocin subtilosin A |
10 | PF04055.23 | 1.0 | 2 | 25.0 | same-strand | Radical SAM superfamily |
11 | PF13186.8 | 1.0 | 2 | 25.0 | same-strand | Iron-sulfur cluster-binding domain |
12 | PF05402.14 | 1.0 | 2 | 25.0 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
13 | PF00005.29 | 1.0 | 2 | 1542.0 | same-strand | ABC transporter |