Result : Q7WDT9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Type IV secretion system protein PtlI homolog |
| NCBI Accession ID | BX640451.1 |
| Organism | Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus) |
| Left | 334271 |
| Right | 334456 |
| Strand | + |
| Nucleotide Sequence | ATGATCCACGCACATTCCAACGCCAGATTATTGCGATGGGCCATCCTGGCCATCGCCCCCGCCACGCTCGGCGCCTGCGCCCCGAACGGGCCGCCCGGCTTGCCGTATCCCGATGGCAAGCCCCTGATTCCCATCAACACCGCCGCCCCGGAGCAAGGATCGTCATGCCAGACCCGCGCCCCTTGA |
| Sequence | MIHAHSNARLLRWAILAIAPATLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRAP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12910271 3584073 8926063 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q7WDT9 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 104688 | 104873 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 2 | 3878447 | 3878632 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 3 | 3955078 | 3955263 | + | NZ_AP019378.1 | Bordetella parapertussis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134326.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00892.22 | 1.0 | 3 | 3821 | opposite-strand | EamA-like transporter family |
| 2 | PF00437.22 | 1.0 | 3 | 2596 | same-strand | Type II/IV secretion system protein |
| 3 | PF03743.16 | 1.0 | 3 | 1479 | same-strand | Bacterial conjugation TrbI-like protein |
| 4 | PF03524.17 | 1.0 | 3 | 677 | same-strand | Conjugal transfer protein |
| 5 | PF04335.15 | 1.0 | 3 | -21 | same-strand | VirB8 protein |
| 6 | PF04610.16 | 1.0 | 3 | -3 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
| 7 | PF03135.16 | 1.0 | 3 | 1396 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
| 8 | PF05101.15 | 1.0 | 3 | 3867 | same-strand | Type IV secretory pathway, VirB3-like protein |
| 9 | PF04956.15 | 1.0 | 3 | 4200 | same-strand | TrbC/VIRB2 pilin |
| 10 | PF02918.17 | 1.0 | 3 | 4564 | same-strand | Pertussis toxin, subunit 2 and 3, C-terminal domain |
| 11 | PF03440.16 | 1.0 | 3 | 4564 | same-strand | Aerolysin/Pertussis toxin (APT) domain |
++ More..