Protein Information |
Information Type | Description |
---|---|
Protein name | Type IV secretion system protein PtlI homolog |
NCBI Accession ID | BX640451.1 |
Organism | Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus) |
Left | 334271 |
Right | 334456 |
Strand | + |
Nucleotide Sequence | ATGATCCACGCACATTCCAACGCCAGATTATTGCGATGGGCCATCCTGGCCATCGCCCCCGCCACGCTCGGCGCCTGCGCCCCGAACGGGCCGCCCGGCTTGCCGTATCCCGATGGCAAGCCCCTGATTCCCATCAACACCGCCGCCCCGGAGCAAGGATCGTCATGCCAGACCCGCGCCCCTTGA |
Sequence | MIHAHSNARLLRWAILAIAPATLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRAP |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 12910271 3584073 8926063 |
Domain | |
Functional Category | Others |
Uniprot ID | Q7WDT9 |
ORF Length (Amino Acid) | 61 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 104688 | 104873 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
2 | 3878447 | 3878632 | + | NC_018518.1 | Bordetella pertussis 18323 |
3 | 3955078 | 3955263 | + | NZ_AP019378.1 | Bordetella parapertussis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00892.22 | 1.0 | 3 | 3821 | opposite-strand | EamA-like transporter family |
2 | PF00437.22 | 1.0 | 3 | 2596 | same-strand | Type II/IV secretion system protein |
3 | PF03743.16 | 1.0 | 3 | 1479 | same-strand | Bacterial conjugation TrbI-like protein |
4 | PF03524.17 | 1.0 | 3 | 677 | same-strand | Conjugal transfer protein |
5 | PF04335.15 | 1.0 | 3 | -21 | same-strand | VirB8 protein |
6 | PF04610.16 | 1.0 | 3 | -3 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
7 | PF03135.16 | 1.0 | 3 | 1396 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
8 | PF05101.15 | 1.0 | 3 | 3867 | same-strand | Type IV secretory pathway, VirB3-like protein |
9 | PF04956.15 | 1.0 | 3 | 4200 | same-strand | TrbC/VIRB2 pilin |
10 | PF02918.17 | 1.0 | 3 | 4564 | same-strand | Pertussis toxin, subunit 2 and 3, C-terminal domain |
11 | PF03440.16 | 1.0 | 3 | 4564 | same-strand | Aerolysin/Pertussis toxin (APT) domain |