Result : A9BE89
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem I reaction center subunit IX |
| NCBI Accession ID | CP000878.1 |
| Organism | Prochlorococcus marinus (strain MIT 9211) |
| Left | 440501 |
| Right | 440635 |
| Strand | - |
| Nucleotide Sequence | ATGTTCAAACTATTCTCAACAAAATGGTTCAGATCTGCCCCAGTAGTAGCAACCATTTGGATTGTTCTTACTGCAGGTATACTTGTTGAATGGAATCGTTTCGTTCCAGACCTTCTGTTCCATCCAGGGTTATAA |
| Sequence | MFKLFSTKWFRSAPVVATIWIVLTAGILVEWNRFVPDLLFHPGL |
| Source of smORF | Swiss-Prot |
| Function | May help in the organization of the PsaE and PsaF subunits. {ECO:0000255|HAMAP-Rule:MF_00522}. |
| Pubmed ID | 18159947 |
| Domain | CDD:420030 |
| Functional Category | Others |
| Uniprot ID | A9BE89 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 446939 | 447073 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 1141805 | 1141933 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 3 | 4343975 | 4344103 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 4 | 329772 | 329900 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 5 | 3504030 | 3504149 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005042.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00814.27 | 0.8 | 4 | 693.0 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
++ More..