Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein FtsL |
NCBI Accession ID | BX640420.1 |
Organism | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
Left | 94300 |
Right | 94578 |
Strand | - |
Nucleotide Sequence | ATGGGGCGCATCAGTCTCATCGTTGCCGCGTTGCTGATGCTGTCGGCCATTTCCCTGGTCACCAGCCGCTACCAGTCGCGCCAGCTCTTCATCGAACTGGGGCGTAGCCAGGCCGAGGCGCGCGATCTCGATACGAACTGGCGCCGCCTGCAGCTGGAGCGGGCCGAGCTGGCGCGCAACGCCCGCATCGACCGTGCCGCGCGTGACGACCTGAAGATGATTCCGATCGTGCCCGACCGCACGCTCTATATGAACCAGCCCGCCGGAGGCGCCCAGTGA |
Sequence | MGRISLIVAALLMLSAISLVTSRYQSRQLFIELGRSQAEARDLDTNWRRLQLERAELARNARIDRAARDDLKMIPIVPDRTLYMNQPAGGAQ |
Source of smORF | Swiss-Prot |
Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00910}. |
Pubmed ID | 12910271 |
Domain | CDD:416267 |
Functional Category | Others |
Uniprot ID | Q7VUP7 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 838747 | 839025 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
2 | 3436667 | 3436945 | - | NC_018518.1 | Bordetella pertussis 18323 |
3 | 3375853 | 3376131 | - | NZ_AP019378.1 | Bordetella parapertussis |
4 | 2332599 | 2332886 | + | NZ_CP021395.1 | Bordetella hinzii |
5 | 3110153 | 3110440 | - | NZ_CP043146.1 | Bordetella holmesii |
6 | 3138730 | 3139005 | - | NC_010645.1 | Bordetella avium 197N |
7 | 700922 | 701209 | + | NZ_CP016440.1 | Bordetella pseudohinzii |
8 | 5621153 | 5621443 | - | NZ_CP038034.1 | Achromobacter insolitus |
9 | 5837134 | 5837424 | + | NZ_CP053986.1 | Achromobacter denitrificans |
10 | 4723290 | 4723574 | - | NZ_CP016171.1 | Bordetella bronchialis |
11 | 3337918 | 3338232 | + | NZ_LR134302.1 | Achromobacter spanius |
12 | 1373778 | 1374068 | + | NZ_CP016172.1 | Bordetella flabilis |
13 | 767830 | 768120 | + | NC_010170.1 | Bordetella petrii |
14 | 1018290 | 1018523 | + | NZ_LT907988.1 | Orrella dioscoreae |
15 | 2035916 | 2036221 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
16 | 2618179 | 2618481 | - | NZ_CP028901.1 | Algicoccus marinus |
17 | 3636867 | 3637121 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
18 | 1492190 | 1492492 | - | NZ_CP013119.1 | Alcaligenes faecalis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01546.30 | 0.72 | 13 | 5258 | same-strand | Peptidase family M20/M25/M40 |
2 | PF07687.16 | 0.72 | 13 | 5258 | same-strand | Peptidase dimerisation domain |
3 | PF01979.22 | 0.72 | 13 | 4182 | same-strand | Amidohydrolase family |
4 | PF00005.29 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter |
5 | PF16326.7 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter C-terminal domain |
6 | PF12848.9 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter |
7 | PF01795.21 | 1.0 | 18 | 0.0 | same-strand | MraW methylase family |
8 | PF00905.24 | 1.0 | 18 | -3.0 | same-strand | Penicillin binding protein transpeptidase domain |
9 | PF03717.17 | 1.0 | 18 | -3.0 | same-strand | Penicillin-binding Protein dimerisation domain |
10 | PF08245.14 | 1.0 | 18 | 1727.0 | same-strand | Mur ligase middle domain |
11 | PF02875.23 | 1.0 | 18 | 1733 | same-strand | Mur ligase family, glutamate ligase domain |
12 | PF01225.27 | 1.0 | 18 | 1724.0 | same-strand | Mur ligase family, catalytic domain |
13 | PF00953.23 | 1.0 | 18 | 4549.5 | same-strand | Glycosyl transferase family 4 |
14 | PF01098.21 | 1.0 | 18 | 7244.5 | same-strand | Cell cycle protein |
15 | PF02381.20 | 0.83 | 15 | 1087 | same-strand | MraZ protein, putative antitoxin-like |