| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsL |
| NCBI Accession ID | BX640420.1 |
| Organism | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Left | 94300 |
| Right | 94578 |
| Strand | - |
| Nucleotide Sequence | ATGGGGCGCATCAGTCTCATCGTTGCCGCGTTGCTGATGCTGTCGGCCATTTCCCTGGTCACCAGCCGCTACCAGTCGCGCCAGCTCTTCATCGAACTGGGGCGTAGCCAGGCCGAGGCGCGCGATCTCGATACGAACTGGCGCCGCCTGCAGCTGGAGCGGGCCGAGCTGGCGCGCAACGCCCGCATCGACCGTGCCGCGCGTGACGACCTGAAGATGATTCCGATCGTGCCCGACCGCACGCTCTATATGAACCAGCCCGCCGGAGGCGCCCAGTGA |
| Sequence | MGRISLIVAALLMLSAISLVTSRYQSRQLFIELGRSQAEARDLDTNWRRLQLERAELARNARIDRAARDDLKMIPIVPDRTLYMNQPAGGAQ |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00910}. |
| Pubmed ID | 12910271 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q7VUP7 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 838747 | 839025 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 2 | 3436667 | 3436945 | - | NC_018518.1 | Bordetella pertussis 18323 |
| 3 | 3375853 | 3376131 | - | NZ_AP019378.1 | Bordetella parapertussis |
| 4 | 2332599 | 2332886 | + | NZ_CP021395.1 | Bordetella hinzii |
| 5 | 3110153 | 3110440 | - | NZ_CP043146.1 | Bordetella holmesii |
| 6 | 3138730 | 3139005 | - | NC_010645.1 | Bordetella avium 197N |
| 7 | 700922 | 701209 | + | NZ_CP016440.1 | Bordetella pseudohinzii |
| 8 | 5621153 | 5621443 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 9 | 5837134 | 5837424 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 10 | 4723290 | 4723574 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 11 | 3337918 | 3338232 | + | NZ_LR134302.1 | Achromobacter spanius |
| 12 | 1373778 | 1374068 | + | NZ_CP016172.1 | Bordetella flabilis |
| 13 | 767830 | 768120 | + | NC_010170.1 | Bordetella petrii |
| 14 | 1018290 | 1018523 | + | NZ_LT907988.1 | Orrella dioscoreae |
| 15 | 2035916 | 2036221 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 16 | 2618179 | 2618481 | - | NZ_CP028901.1 | Algicoccus marinus |
| 17 | 3636867 | 3637121 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 18 | 1492190 | 1492492 | - | NZ_CP013119.1 | Alcaligenes faecalis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01546.30 | 0.72 | 13 | 5258 | same-strand | Peptidase family M20/M25/M40 |
| 2 | PF07687.16 | 0.72 | 13 | 5258 | same-strand | Peptidase dimerisation domain |
| 3 | PF01979.22 | 0.72 | 13 | 4182 | same-strand | Amidohydrolase family |
| 4 | PF00005.29 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter |
| 5 | PF16326.7 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter C-terminal domain |
| 6 | PF12848.9 | 0.94 | 17 | 2334 | opposite-strand | ABC transporter |
| 7 | PF01795.21 | 1.0 | 18 | 0.0 | same-strand | MraW methylase family |
| 8 | PF00905.24 | 1.0 | 18 | -3.0 | same-strand | Penicillin binding protein transpeptidase domain |
| 9 | PF03717.17 | 1.0 | 18 | -3.0 | same-strand | Penicillin-binding Protein dimerisation domain |
| 10 | PF08245.14 | 1.0 | 18 | 1727.0 | same-strand | Mur ligase middle domain |
| 11 | PF02875.23 | 1.0 | 18 | 1733 | same-strand | Mur ligase family, glutamate ligase domain |
| 12 | PF01225.27 | 1.0 | 18 | 1724.0 | same-strand | Mur ligase family, catalytic domain |
| 13 | PF00953.23 | 1.0 | 18 | 4549.5 | same-strand | Glycosyl transferase family 4 |
| 14 | PF01098.21 | 1.0 | 18 | 7244.5 | same-strand | Cell cycle protein |
| 15 | PF02381.20 | 0.83 | 15 | 1087 | same-strand | MraZ protein, putative antitoxin-like |