Result : Q7VR46
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0434 protein Bfl377 |
| NCBI Accession ID | BX248583.1 |
| Organism | Blochmannia floridanus |
| Left | 413503 |
| Right | 413688 |
| Strand | - |
| Nucleotide Sequence | ATGCAAAAAAAATTATTAGAAATTATCGTTTGTCCTTTTTGTTATACACGGTTATTTATGAATGATACAGAAACAGAATTAATTTGTAATATTGAGAACATTAGTTTTCCTCTAAAACAAGGAATTCCAGTTTTATTAAAAAATCAAATTCGATATTTGAATTGCAAAATTATAGATAACCAATGA |
| Sequence | MQKKLLEIIVCPFCYTRLFMNDTETELICNIENISFPLKQGIPVLLKNQIRYLNCKIIDNQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01066. Profile Description: Trm112p-like protein. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C-terminus contains the strongest conservation. Trm112p is required for tRNA methylation in S. cerevisiae and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices. |
| Pubmed ID | 12886019 |
| Domain | CDD:412721 |
| Functional Category | Others |
| Uniprot ID | Q7VR46 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1074488 | 1074670 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3511092 | 3511274 | + | NZ_CP053416.1 | Salmonella bongori |
| 3 | 1590757 | 1590939 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 4 | 4135224 | 4135406 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 5 | 1546011 | 1546193 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 6 | 637239 | 637421 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 7 | 4478888 | 4479070 | + | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 1470936 | 1471118 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 9 | 954458 | 954640 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 970673 | 970855 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 11 | 1100316 | 1100498 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 12 | 1992799 | 1992981 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 13 | 1738408 | 1738590 | - | NZ_CP038469.1 | Citrobacter tructae |
| 14 | 1084715 | 1084897 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00216.23 | 0.92 | 12 | 6556 | same-strand | Bacterial DNA-binding protein |
| 2 | PF03772.18 | 1.0 | 13 | 4087.0 | same-strand | Competence protein |
| 3 | PF00753.29 | 1.0 | 13 | 4087.0 | same-strand | Metallo-beta-lactamase superfamily |
| 4 | PF13567.8 | 0.69 | 9 | 4087.0 | same-strand | Domain of unknown function (DUF4131) |
| 5 | PF00664.25 | 1.0 | 13 | 2302.0 | same-strand | ABC transporter transmembrane region |
| 6 | PF00005.29 | 1.0 | 13 | 2302.0 | same-strand | ABC transporter |
| 7 | PF02463.21 | 1.0 | 13 | 2302.0 | same-strand | RecF/RecN/SMC N terminal domain |
| 8 | PF13191.8 | 1.0 | 13 | 2302.0 | same-strand | AAA ATPase domain |
| 9 | PF00270.31 | 1.0 | 13 | 2302.0 | same-strand | DEAD/DEAH box helicase |
| 10 | PF02606.16 | 1.0 | 13 | 1324.5 | same-strand | Tetraacyldisaccharide-1-P 4'-kinase |
| 11 | PF06224.14 | 1.0 | 13 | 52.0 | same-strand | Winged helix DNA-binding domain |
| 12 | PF02348.21 | 1.0 | 13 | -3.0 | same-strand | Cytidylyltransferase |
| 13 | PF02698.19 | 1.0 | 13 | 1809.5 | opposite-strand | DUF218 domain |
| 14 | PF13649.8 | 0.85 | 11 | 2695.0 | same-strand | Methyltransferase domain |
| 15 | PF08241.14 | 0.85 | 11 | 2695.0 | same-strand | Methyltransferase domain |
| 16 | PF08242.14 | 0.85 | 11 | 2695.0 | same-strand | Methyltransferase domain |
| 17 | PF17192.6 | 0.85 | 11 | 3478.0 | same-strand | MukF middle domain |
| 18 | PF17193.6 | 0.85 | 11 | 3478.0 | same-strand | MukF C-terminal domain |
| 19 | PF03882.16 | 0.85 | 11 | 3478.0 | same-strand | MukF winged-helix domain |
++ More..