Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center protein H (PSII-H) |
NCBI Accession ID | CP000878.1 |
Organism | Prochlorococcus marinus (strain MIT 9211) |
Left | 262427 |
Right | 262630 |
Strand | - |
Nucleotide Sequence | ATGGGACAAAAAACAGCTCTAGGATCTCTACTGAAATCCATTGGTAATTCTGGCCAAGGCAAGGTTGTAGCTGGCTGGGGAGCAGTACCAGTTATGGCTTTTATTGGTGTCTTGCTTCTGGTATTTTTAGTAATTCTTCTACAGATTTACAACCAGTCTCTGCTTTTACAGGGTTTCTCTGTTGATTGGAACGGGGTTAAATAG |
Sequence | MGQKTALGSLLKSIGNSGQGKVVAGWGAVPVMAFIGVLLLVFLVILLQIYNQSLLLQGFSVDWNGVK |
Source of smORF | Swiss-Prot |
Function | One of the components of the core complex of photosystem II (PSII), required for its stability and/or assembly. PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00752}. |
Pubmed ID | 18159947 |
Domain | CDD:420012 |
Functional Category | Others |
Uniprot ID | A9BDM2 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 275064 | 275267 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
2 | 1113308 | 1113511 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
3 | 2183350 | 2183550 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
4 | 1436053 | 1436256 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
5 | 1683478 | 1683681 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
6 | 5405679 | 5405882 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
7 | 1991231 | 1991431 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
8 | 1118643 | 1118846 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
9 | 915367 | 915561 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
10 | 2616298 | 2616501 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
11 | 699395 | 699595 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
12 | 6050609 | 6050812 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
13 | 5547745 | 5547948 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
14 | 6081637 | 6081840 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
15 | 367231 | 367434 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
16 | 3945470 | 3945673 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
17 | 4699237 | 4699440 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
18 | 4963324 | 4963518 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
19 | 3939248 | 3939451 | + | NZ_CP031941.1 | Nostoc sphaeroides |
20 | 507197 | 507385 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
21 | 5750199 | 5750408 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02416.18 | 0.9 | 19 | 150 | same-strand | mttA/Hcf106 family |
2 | PF02468.17 | 0.81 | 17 | 86 | opposite-strand | Photosystem II reaction centre N protein (psbN) |