Result : Q7VPK3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | FAD assembly factor SdhE |
| NCBI Accession ID | AE017143.1 |
| Organism | Haemophilus ducreyi (strain 35000HP / ATCC 700724) |
| Left | 55240 |
| Right | 55488 |
| Strand | + |
| Nucleotide Sequence | ATGGCAGAATTAAACCGCTTTAAGATTGAATGGCAATGCCGGCGAGGAATGCGAGAATTGGATAAGATGATTATGCCATTTTATCAACAGTATTTTGAACAACTGAGTGAAGCTGAACAGCGAACTTTTGTAACAATGTTAAGTTATACTGACCCCGAATTATTCCGTTGGGTTATGCATCAATCCCCTGCACCAACAGTGGCAATCAGTGCGTTAATTGAACGTATTCGTGCAAGCATTGAAGCATAA |
| Sequence | MAELNRFKIEWQCRRGMRELDKMIMPFYQQYFEQLSEAEQRTFVTMLSYTDPELFRWVMHQSPAPTVAISALIERIRASIEA |
| Source of smORF | Swiss-Prot |
| Function | An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins. Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH and other flavinylated proteins as well. {ECO:0000250|UniProtKB:G4V4G2}. |
| Pubmed ID | |
| Domain | CDD:412748 |
| Functional Category | Others |
| Uniprot ID | Q7VPK3 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 731372 | 731620 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 2 | 1779980 | 1780228 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 3 | 2152123 | 2152371 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 4 | 1948585 | 1948833 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 5 | 114151 | 114393 | + | NZ_CP016604.1 | Otariodibacter oris |
| 6 | 592990 | 593238 | - | NZ_CP061280.1 | Mannheimia bovis |
| 7 | 2018391 | 2018639 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 8 | 746814 | 747062 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 9 | 291885 | 292133 | + | NZ_CP046531.1 | Mannheimia ovis |
| 10 | 321608 | 321856 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 11 | 175040 | 175288 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 12 | 339303 | 339503 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 13 | 2201038 | 2201238 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 14 | 79468 | 79668 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 15 | 1283632 | 1283871 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015425.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02401.20 | 1.0 | 15 | 0 | same-strand | LytB protein |
| 2 | PF01252.20 | 1.0 | 15 | 945 | same-strand | Signal peptidase (SPase) II |
| 3 | PF00543.24 | 1.0 | 15 | 1507 | same-strand | Nitrogen regulatory protein P-II |
| 4 | PF00994.26 | 0.87 | 13 | 1863 | same-strand | Probable molybdopterin binding domain |
++ More..