Result : Q7VM69
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AE017143.1 |
| Organism | Haemophilus ducreyi (strain 35000HP / ATCC 700724) |
| Left | 896877 |
| Right | 897065 |
| Strand | + |
| Nucleotide Sequence | ATGTTACACACGATAGTAAATTGCCCAACTTGTGCAAAACAAGTCATATGGGATCCAGTAAGTAAATATCGGCCATTTTGTAGTGAACGTTGTCAATTGATTGATTTAGGTGAGTGGGCAAATGAAGAGAAACGGATTGCTAGCGTTGAAGATGAGGCAATGCACTATACATTTGAGAACAATGATTAA |
| Sequence | MLHTIVNCPTCAKQVIWDPVSKYRPFCSERCQLIDLGEWANEEKRIASVEDEAMHYTFENND |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q7VM69 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 79
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 197184 | 197372 | - | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 2 | 1144542 | 1144730 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 3 | 1130652 | 1130840 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 4 | 1023453 | 1023641 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 5 | 1915927 | 1916112 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 6 | 1155764 | 1155949 | - | NZ_CP015029.1 | Frederiksenia canicola |
| 7 | 3241006 | 3241206 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 8 | 2627073 | 2627273 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 9 | 806442 | 806642 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 10 | 880506 | 880664 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 11 | 1224486 | 1224671 | + | NZ_CP046531.1 | Mannheimia ovis |
| 12 | 1375581 | 1375766 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 13 | 3374810 | 3375010 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 14 | 1792467 | 1792652 | - | NZ_CP061280.1 | Mannheimia bovis |
| 15 | 1001848 | 1002033 | + | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 16 | 708064 | 708246 | - | NZ_CP016604.1 | Otariodibacter oris |
| 17 | 861247 | 861432 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 18 | 2566934 | 2567128 | + | NZ_CP038469.1 | Citrobacter tructae |
| 19 | 812034 | 812234 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 20 | 803867 | 804067 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 21 | 528783 | 528980 | - | NZ_CP065534.1 | Lonsdalea populi |
| 22 | 2725711 | 2725908 | - | NZ_CP011254.1 | Serratia fonticola |
| 23 | 2366584 | 2366775 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
| 24 | 725537 | 725728 | + | NZ_CP016180.1 | Pasteurella skyensis |
| 25 | 2997478 | 2997678 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 26 | 5161047 | 5161241 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 27 | 971080 | 971280 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 28 | 1377255 | 1377461 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 29 | 3506081 | 3506263 | - | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 30 | 47640 | 47816 | + | NZ_CP072524.1 | Neisseria sicca |
| 31 | 733899 | 734093 | - | NZ_LR134340.1 | Escherichia marmotae |
| 32 | 1727395 | 1727583 | - | NZ_LR134516.1 | Neisseria animaloris |
| 33 | 660865 | 661050 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 34 | 4332093 | 4332284 | + | NZ_CP050851.1 | Aeromonas hydrophila |
| 35 | 4059388 | 4059582 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 36 | 2130253 | 2130444 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 37 | 2205908 | 2206126 | - | NZ_CP015031.1 | Basfia succiniciproducens |
| 38 | 332410 | 332628 | - | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 39 | 2014950 | 2015150 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 40 | 5770662 | 5770823 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 41 | 2826894 | 2827079 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 42 | 5187952 | 5188113 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 43 | 1513920 | 1514102 | + | NZ_CP039887.1 | Neisseria subflava |
| 44 | 1534757 | 1534939 | + | NZ_CP039886.1 | Neisseria flavescens |
| 45 | 1749612 | 1749812 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 46 | 2501706 | 2501897 | + | NC_021287.1 | Caballeronia insecticola |
| 47 | 1610273 | 1610455 | + | NZ_CP038018.1 | Eikenella exigua |
| 48 | 1932751 | 1932954 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 49 | 1256103 | 1256258 | + | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 50 | 5710041 | 5710247 | + | NZ_CP035088.1 | Pseudomonas viciae |
| 51 | 1166933 | 1167130 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 52 | 733560 | 733742 | + | NZ_LT906482.1 | Eikenella corrodens |
| 53 | 767040 | 767240 | - | NZ_CP014870.1 | Pseudomonas silesiensis |
| 54 | 2587058 | 2587264 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 55 | 4087281 | 4087472 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 56 | 5737471 | 5737626 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 57 | 5581717 | 5581872 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 58 | 261663 | 261881 | - | NZ_CP025491.2 | Legionella sainthelensi |
| 59 | 260979 | 261176 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 60 | 1451605 | 1451796 | + | NC_008709.1 | Psychromonas ingrahamii 37 |
| 61 | 645635 | 645814 | - | NZ_CP025120.1 | Kangiella profundi |
| 62 | 3169754 | 3169954 | + | NZ_CP016022.1 | Ralstonia insidiosa |
| 63 | 2014084 | 2014299 | + | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 64 | 413594 | 413779 | - | NZ_CP037993.1 | Herbaspirillum huttiense |
| 65 | 2214651 | 2214845 | - | NC_017856.1 | Methylophaga frappieri |
| 66 | 4875833 | 4876033 | - | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 67 | 293167 | 293346 | + | NZ_CP018787.1 | Oxalobacter formigenes |
| 68 | 604641 | 604823 | - | NZ_AP012273.1 | Thiolapillus brandeum |
| 69 | 3903704 | 3903889 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 70 | 903608 | 903802 | - | NZ_CP068551.1 | Pseudomonas khazarica |
| 71 | 3205585 | 3205773 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 72 | 3229011 | 3229202 | + | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 73 | 747986 | 748171 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 74 | 715104 | 715289 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 75 | 4327975 | 4328169 | + | NZ_CP060009.1 | Pseudomonas sediminis |
| 76 | 905347 | 905511 | + | NZ_LT906434.1 | Neisseria zoodegmatis |
| 77 | 5004148 | 5004312 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 78 | 4130299 | 4130493 | + | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 79 | 3231212 | 3231406 | - | NZ_CP070505.1 | Pseudomonas toyotomiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030753.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01121.22 | 0.91 | 72 | 753.0 | same-strand | Dephospho-CoA kinase |
| 2 | PF00482.25 | 0.86 | 68 | 2243.5 | same-strand | Type II secretion system (T2SS), protein F |
| 3 | PF00437.22 | 0.84 | 66 | 3326.5 | same-strand | Type II/IV secretion system protein |
| 4 | PF01478.20 | 0.65 | 51 | 783 | same-strand | Type IV leader peptidase family |
++ More..