Result : Q7VLP9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein HD_1373 |
| NCBI Accession ID | AE017143.1 |
| Organism | Haemophilus ducreyi (strain 35000HP / ATCC 700724) |
| Left | 1121866 |
| Right | 1122165 |
| Strand | + |
| Nucleotide Sequence | ATGTATATAGTGATGAATTCTAATTTTTGTGCTATTTATAAAAGTATGAGTAAAGAAGGTATGTTCCTTTATATCGCTCAACGTGATAAATTTAATGCTGTTCCTGAGCAGTTATTACAAATGTTTGGTAAACCACAATTCGTGATGTTATTTAATTTAGCGGGAGAAAAACCGCTTAAACAAGTAAATAATCAGGATGTTTTGTTGGCAATTAAAACACAAGGCTTTTTTTTACAAATATCACCACCTGCGGAAAATTTGCTTAAGCAATTCCTTATTCAAAAGGGAGAAAAGAAATAA |
| Sequence | MYIVMNSNFCAIYKSMSKEGMFLYIAQRDKFNAVPEQLLQMFGKPQFVMLFNLAGEKPLKQVNNQDVLLAIKTQGFFLQISPPAENLLKQFLIQKGEKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | Q7VLP9 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 45781 | 46080 | + | NZ_CP015425.1 | [Haemophilus] ducreyi |
| 2 | 728042 | 728335 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 3 | 704326 | 704619 | + | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 4 | 834278 | 834571 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 5 | 1778659 | 1778949 | - | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 6 | 1336590 | 1336838 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 7 | 187583 | 187861 | + | NC_011852.1 | Glaesserella parasuis SH0165 |
| 8 | 696784 | 697035 | + | NZ_CP016604.1 | Otariodibacter oris |
| 9 | 1509005 | 1509310 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 10 | 923539 | 923790 | + | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 11 | 1504398 | 1504691 | + | NZ_CP061280.1 | Mannheimia bovis |
| 12 | 1478515 | 1478817 | + | NZ_CP055305.1 | Mannheimia pernigra |
| 13 | 1318748 | 1319050 | + | NZ_CP046531.1 | Mannheimia ovis |
| 14 | 652621 | 652884 | - | NZ_CP016180.1 | Pasteurella skyensis |
| 15 | 1031508 | 1031777 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 16 | 663105 | 663362 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 17 | 1230410 | 1230661 | + | NZ_LR134510.1 | Actinobacillus delphinicola |
| 18 | 1265395 | 1265670 | - | NZ_LR134167.1 | Avibacterium volantium |
| 19 | 1216939 | 1217217 | - | NZ_CP018804.1 | Histophilus somni |
| 20 | 1950178 | 1950459 | - | NZ_AP019657.1 | Vibrio ponticus |
| 21 | 1743351 | 1743629 | - | NZ_CP014035.2 | Vibrio fluvialis |
| 22 | 1500041 | 1500319 | + | NZ_CP040990.1 | Vibrio furnissii |
| 23 | 2427603 | 2427878 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 24 | 1780468 | 1780734 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 25 | 1966017 | 1966325 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 26 | 1636899 | 1637177 | - | NZ_CP035688.1 | Vibrio metoecus |
| 27 | 1220922 | 1221176 | + | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 28 | 1766184 | 1766474 | - | NZ_CP033078.1 | Vibrio zhugei |
| 29 | 2389418 | 2389699 | - | NZ_AP014635.1 | Vibrio tritonius |
| 30 | 1368057 | 1368323 | + | NZ_LS483458.1 | Haemophilus haemolyticus |
| 31 | 908428 | 908718 | + | NC_011753.2 | Vibrio atlanticus |
| 32 | 17798 | 18049 | - | NZ_CP028926.1 | Pasteurella multocida |
| 33 | 686416 | 686667 | + | NZ_LT906448.1 | Pasteurella dagmatis |
++ More..