Result : Q7VJW9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | AE017125.1 |
| Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
| Left | 119335 |
| Right | 119574 |
| Strand | - |
| Nucleotide Sequence | ATGTTGATACTTTCAAGAAAACAAGATGACAGCGTGATAATTGGCGATGATATTGAAATAAAGATTATCTCCATTGACAAAGGCAGCGTGAGACTCGGGTTTTCTGCACCAGAAAATTGTGTGATTTTACGTGGAGAGCTTAAAGAGGCAATTACTTCACAGAACAAACAAGCTTCGCAAAGTGATGATATAAAAGCTGTATCAGAGATAAAGTTTTTGCTTAAAGCCCATAAGAAATGA |
| Sequence | MLILSRKQDDSVIIGDDIEIKIISIDKGSVRLGFSAPENCVILRGELKEAITSQNKQASQSDDIKAVSEIKFLLKAHKK |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 12810954 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | Q7VJW9 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 119335 | 119574 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 2 | 1172452 | 1172697 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 3 | 1174533 | 1174787 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 4 | 868349 | 868579 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 5 | 149691 | 149921 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 6 | 1472753 | 1472983 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 7 | 158366 | 158596 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 8 | 835921 | 836151 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 9 | 1158804 | 1159037 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 10 | 760582 | 760809 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 11 | 1288376 | 1288603 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004917.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02472.18 | 0.64 | 7 | 1747 | same-strand | Biopolymer transport protein ExbD/TolR |
| 2 | PF01668.20 | 0.91 | 10 | 803.5 | same-strand | SmpB protein |
| 3 | PF00288.28 | 0.91 | 10 | 0.5 | same-strand | GHMP kinases N terminal domain |
| 4 | PF01509.20 | 0.73 | 8 | -9.0 | same-strand | TruB family pseudouridylate synthase (N terminal domain) |
++ More..