Result : Q7VJW4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AE017125.1 |
| Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
| Left | 124390 |
| Right | 124680 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAAAGATGTGAATTTTTAATATTTGGTAAGGTGCAAGGTGTAGGTTTTAGACGTTTTGTTAAATATAGGGTTGATAAGCTTAATGAAGAAAGTAAGGTTTTAAGCGGGAATGTATGTAATTTAAGCGATGGTAGCGTGCGTGTAATAGCACAAGGCGAAGAAGAAGCACTTGAAAAATTATGTAAAATACTTGAGATTGGACCTATTAAAAGCGAGGTTGAACGAATACAATCTCGCGAAATAGATATTGATGAGAGTCTCAATGATTTTGAGATTTTAAGATAA |
| Sequence | MKKRCEFLIFGKVQGVGFRRFVKYRVDKLNEESKVLSGNVCNLSDGSVRVIAQGEEEALEKLCKILEIGPIKSEVERIQSREIDIDESLNDFEILR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 12810954 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q7VJW4 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 124390 | 124680 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 2 | 668644 | 668931 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 3 | 1095037 | 1095327 | - | NZ_LN907858.1 | Helicobacter typhlonius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LN907858.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13637.8 | 1.0 | 3 | 2040.0 | same-strand | Ankyrin repeats (many copies) |
| 2 | PF00023.32 | 1.0 | 3 | 2012 | same-strand | Ankyrin repeat |
| 3 | PF13606.8 | 1.0 | 3 | 2012 | same-strand | Ankyrin repeat |
| 4 | PF13857.8 | 0.67 | 2 | 2005.5 | same-strand | Ankyrin repeats (many copies) |
| 5 | PF01230.25 | 1.0 | 3 | 1512 | same-strand | HIT domain |
| 6 | PF11969.10 | 1.0 | 3 | 1512 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
| 7 | PF08245.14 | 1.0 | 3 | 11 | same-strand | Mur ligase middle domain |
| 8 | PF02875.23 | 1.0 | 3 | 11 | same-strand | Mur ligase family, glutamate ligase domain |
| 9 | PF07478.15 | 0.67 | 2 | 772.5 | same-strand | D-ala D-ala ligase C-terminus |
| 10 | PF01820.23 | 1.0 | 3 | 755 | same-strand | D-ala D-ala ligase N-terminus |
| 11 | PF17760.3 | 1.0 | 3 | 1808 | same-strand | UvrA interaction domain |
| 12 | PF17755.3 | 1.0 | 3 | 1808 | same-strand | UvrA DNA-binding domain |
| 13 | PF02826.21 | 1.0 | 3 | 4987 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
| 14 | PF00389.32 | 1.0 | 3 | 4987 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
| 15 | PF19304.1 | 1.0 | 3 | 4987 | same-strand | D-3-phosphoglycerate dehydrogenase intervening domain |
| 16 | PF01842.27 | 1.0 | 3 | 4987 | same-strand | ACT domain |
| 17 | PF01810.20 | 0.67 | 2 | 2945.0 | opposite-strand | LysE type translocator |
| 18 | PF00521.22 | 0.67 | 2 | 3689.5 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
| 19 | PF03989.15 | 0.67 | 2 | 3689.5 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
++ More..