Protein Information |
Information Type | Description |
---|---|
Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
NCBI Accession ID | AE017125.1 |
Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
Left | 124390 |
Right | 124680 |
Strand | - |
Nucleotide Sequence | ATGAAAAAAAGATGTGAATTTTTAATATTTGGTAAGGTGCAAGGTGTAGGTTTTAGACGTTTTGTTAAATATAGGGTTGATAAGCTTAATGAAGAAAGTAAGGTTTTAAGCGGGAATGTATGTAATTTAAGCGATGGTAGCGTGCGTGTAATAGCACAAGGCGAAGAAGAAGCACTTGAAAAATTATGTAAAATACTTGAGATTGGACCTATTAAAAGCGAGGTTGAACGAATACAATCTCGCGAAATAGATATTGATGAGAGTCTCAATGATTTTGAGATTTTAAGATAA |
Sequence | MKKRCEFLIFGKVQGVGFRRFVKYRVDKLNEESKVLSGNVCNLSDGSVRVIAQGEEEALEKLCKILEIGPIKSEVERIQSREIDIDESLNDFEILR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
Pubmed ID | 12810954 |
Domain | CDD:412440 |
Functional Category | Others |
Uniprot ID | Q7VJW4 |
ORF Length (Amino Acid) | 96 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 124390 | 124680 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
2 | 668644 | 668931 | + | NZ_AP018676.1 | Helicobacter cinaedi |
3 | 1095037 | 1095327 | - | NZ_LN907858.1 | Helicobacter typhlonius |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13637.8 | 1.0 | 3 | 2040.0 | same-strand | Ankyrin repeats (many copies) |
2 | PF00023.32 | 1.0 | 3 | 2012 | same-strand | Ankyrin repeat |
3 | PF13606.8 | 1.0 | 3 | 2012 | same-strand | Ankyrin repeat |
4 | PF13857.8 | 0.67 | 2 | 2005.5 | same-strand | Ankyrin repeats (many copies) |
5 | PF01230.25 | 1.0 | 3 | 1512 | same-strand | HIT domain |
6 | PF11969.10 | 1.0 | 3 | 1512 | same-strand | Scavenger mRNA decapping enzyme C-term binding |
7 | PF08245.14 | 1.0 | 3 | 11 | same-strand | Mur ligase middle domain |
8 | PF02875.23 | 1.0 | 3 | 11 | same-strand | Mur ligase family, glutamate ligase domain |
9 | PF07478.15 | 0.67 | 2 | 772.5 | same-strand | D-ala D-ala ligase C-terminus |
10 | PF01820.23 | 1.0 | 3 | 755 | same-strand | D-ala D-ala ligase N-terminus |
11 | PF17760.3 | 1.0 | 3 | 1808 | same-strand | UvrA interaction domain |
12 | PF17755.3 | 1.0 | 3 | 1808 | same-strand | UvrA DNA-binding domain |
13 | PF02826.21 | 1.0 | 3 | 4987 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
14 | PF00389.32 | 1.0 | 3 | 4987 | same-strand | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain |
15 | PF19304.1 | 1.0 | 3 | 4987 | same-strand | D-3-phosphoglycerate dehydrogenase intervening domain |
16 | PF01842.27 | 1.0 | 3 | 4987 | same-strand | ACT domain |
17 | PF01810.20 | 0.67 | 2 | 2945.0 | opposite-strand | LysE type translocator |
18 | PF00521.22 | 0.67 | 2 | 3689.5 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
19 | PF03989.15 | 0.67 | 2 | 3689.5 | same-strand | DNA gyrase C-terminal domain, beta-propeller |