ProsmORF-pred
Result : A9BCH8
Protein Information
Information Type Description
Protein name 30S ribosomal protein S20
NCBI Accession ID CP000878.1
Organism Prochlorococcus marinus (strain MIT 9211)
Left 1440902
Right 1441204
Strand -
Nucleotide Sequence GTGGCAAATAACAATTCCGCGAAGAAGCGAATACAGATTGCTGAGCGCAATCGCCTGCAAAACAGATCTTATAAGTCTGCCATGAGGACTTTGATGAAAAGATGTTTAACTGCAGCTGGTTCTTATCTTGAAAAACCTGGTGAAGAAGCAAAGGCTAATCTTCAACAAAATATCAATGAGGCATTTAGTAAAATTGATAAGGCTGTAAAGAAAGGGGTTTTGCATCGCAATAATGGAGCAAATAAAAAATCTCGTTTAAATGCTGCTGTTAAAAAGCTCATTGAGCCAGCAACTAAGCGCTAG
Sequence MANNNSAKKRIQIAERNRLQNRSYKSAMRTLMKRCLTAAGSYLEKPGEEAKANLQQNINEAFSKIDKAVKKGVLHRNNGANKKSRLNAAVKKLIEPATKR
Source of smORF Swiss-Prot
Function Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}.
Pubmed ID 18159947
Domain CDD:412349
Functional Category Ribosomal_protein
Uniprot ID A9BCH8
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 30
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1500568 1500867 - NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
2 2954025 2954339 + NC_019675.1 Cyanobium gracile PCC 6307
3 3012706 3013005 - NC_019753.1 Crinalium epipsammum PCC 9333
4 6876081 6876380 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
5 5010274 5010567 + NC_010296.1 Microcystis aeruginosa NIES-843
6 7594492 7594797 - NC_019693.1 Oscillatoria acuminata PCC 6304
7 5788253 5788546 - NC_014501.1 Gloeothece verrucosa PCC 7822
8 1340961 1341257 - NZ_AP018202.1 Thermostichus vulcanus NIES-2134
9 1227936 1228232 - NC_004113.1 Thermosynechococcus vestitus BP-1
10 495480 495782 + NC_019695.1 Chroococcidiopsis thermalis PCC 7203
11 646169 646459 - NC_019780.1 Dactylococcopsis salina PCC 8305
12 1088813 1089097 - NC_014248.1 'Nostoc azollae' 0708
13 4268034 4268327 + NC_019689.1 Pleurocapsa sp. PCC 7327
14 2758156 2758449 + NZ_CP060822.1 Cylindrospermopsis curvispora GIHE-G1
15 820323 820616 + NC_011729.1 Gloeothece citriformis PCC 7424
16 2960983 2961279 - NC_019771.1 Anabaena cylindrica PCC 7122
17 1884025 1884324 + NC_019776.1 Cyanobacterium aponinum PCC 10605
18 3578718 3579020 - NC_019751.1 Calothrix sp. PCC 6303
19 5937224 5937520 + NZ_CP031941.1 Nostoc sphaeroides
20 3703137 3703436 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
21 202575 202868 + NZ_CP047242.1 Trichormus variabilis 0441
22 40382 40681 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
23 6169437 6169736 + NC_010628.1 Nostoc punctiforme PCC 73102
24 2208861 2209148 + NZ_CP042326.1 Euhalothece natronophila Z-M001
25 1304500 1304796 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
26 1637904 1638200 + NC_019748.1 Stanieria cyanosphaera PCC 7437
27 3917188 3917487 + NZ_CP021983.2 Halomicronema hongdechloris C2206
28 2122886 2123179 - NZ_CP018092.1 Synechococcus lividus PCC 6715
29 3639977 3640261 + NC_009925.1 Acaryochloris marina MBIC11017
30 3309411 3309719 - NC_022600.1 Gloeobacter kilaueensis JS1
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_005042.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF04997.14 0.7 21 4867 same-strand RNA polymerase Rpb1, domain 1
2 PF00562.30 0.87 26 1294.0 same-strand RNA polymerase Rpb2, domain 6
3 PF04561.16 0.87 26 1294.0 same-strand RNA polymerase Rpb2, domain 2
4 PF04565.18 0.87 26 1294.0 same-strand RNA polymerase Rpb2, domain 3
5 PF04560.22 0.87 26 1294.0 same-strand RNA polymerase Rpb2, domain 7
6 PF04563.17 0.87 26 1294.0 same-strand RNA polymerase beta subunit
7 PF10385.11 0.87 26 1294.0 same-strand RNA polymerase beta subunit external 1 domain
8 PF01026.23 0.97 29 86 same-strand TatD related DNase
9 PF00815.22 0.73 22 317.5 opposite-strand Histidinol dehydrogenase
++ More..