Result : A9BCH8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | CP000878.1 |
| Organism | Prochlorococcus marinus (strain MIT 9211) |
| Left | 1440902 |
| Right | 1441204 |
| Strand | - |
| Nucleotide Sequence | GTGGCAAATAACAATTCCGCGAAGAAGCGAATACAGATTGCTGAGCGCAATCGCCTGCAAAACAGATCTTATAAGTCTGCCATGAGGACTTTGATGAAAAGATGTTTAACTGCAGCTGGTTCTTATCTTGAAAAACCTGGTGAAGAAGCAAAGGCTAATCTTCAACAAAATATCAATGAGGCATTTAGTAAAATTGATAAGGCTGTAAAGAAAGGGGTTTTGCATCGCAATAATGGAGCAAATAAAAAATCTCGTTTAAATGCTGCTGTTAAAAAGCTCATTGAGCCAGCAACTAAGCGCTAG |
| Sequence | MANNNSAKKRIQIAERNRLQNRSYKSAMRTLMKRCLTAAGSYLEKPGEEAKANLQQNINEAFSKIDKAVKKGVLHRNNGANKKSRLNAAVKKLIEPATKR |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 18159947 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9BCH8 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1500568 | 1500867 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 2954025 | 2954339 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 3 | 3012706 | 3013005 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 4 | 6876081 | 6876380 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 5 | 5010274 | 5010567 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 6 | 7594492 | 7594797 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 7 | 5788253 | 5788546 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 8 | 1340961 | 1341257 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 9 | 1227936 | 1228232 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 10 | 495480 | 495782 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 11 | 646169 | 646459 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 12 | 1088813 | 1089097 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 13 | 4268034 | 4268327 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 14 | 2758156 | 2758449 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 15 | 820323 | 820616 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 16 | 2960983 | 2961279 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 17 | 1884025 | 1884324 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 18 | 3578718 | 3579020 | - | NC_019751.1 | Calothrix sp. PCC 6303 |
| 19 | 5937224 | 5937520 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 20 | 3703137 | 3703436 | + | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 21 | 202575 | 202868 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 22 | 40382 | 40681 | + | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 23 | 6169437 | 6169736 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 24 | 2208861 | 2209148 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 25 | 1304500 | 1304796 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 26 | 1637904 | 1638200 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 27 | 3917188 | 3917487 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 28 | 2122886 | 2123179 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 29 | 3639977 | 3640261 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 30 | 3309411 | 3309719 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005042.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04997.14 | 0.7 | 21 | 4867 | same-strand | RNA polymerase Rpb1, domain 1 |
| 2 | PF00562.30 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase Rpb2, domain 6 |
| 3 | PF04561.16 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase Rpb2, domain 2 |
| 4 | PF04565.18 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase Rpb2, domain 3 |
| 5 | PF04560.22 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase Rpb2, domain 7 |
| 6 | PF04563.17 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase beta subunit |
| 7 | PF10385.11 | 0.87 | 26 | 1294.0 | same-strand | RNA polymerase beta subunit external 1 domain |
| 8 | PF01026.23 | 0.97 | 29 | 86 | same-strand | TatD related DNase |
| 9 | PF00815.22 | 0.73 | 22 | 317.5 | opposite-strand | Histidinol dehydrogenase |
++ More..