Result : Q7VIA0

Protein Information

• Protein name: Sec-independent protein translocase protein TatA
• NCBI Accession ID: AE017125.1
• Organism: Helicobacter hepaticus (strain ATCC 51449 / 3B1)
• Left: 687718
• Right: 687966
• Strand: +
• Nucleotide Sequence: ATGCACCCCCCTAGTATTACACAATTGTTGATTATTTTGCTTATTATTGTGCTCCTTTTTGGTGCAAAAAAAATTCCCGAACTTGCAAAAGGATTAGGAAGTGGTATTAAAAACTTCAAAAAAGCTGTCAAAGAAGATGAAGAAGATAATCAAAGTGAAGAAAATACAAAATCTCAAATCAAACAAAGCGAATCTAAAAATGAGAATGTATCAAAAACTCACACAGATTCTCAAAAACAAGACACTTAA
• Sequence: MHPPSITQLLIILLIIVLLFGAKKIPELAKGLGSGIKNFKKAVKEDEEDNQSEENTKSQIKQSESKNENVSKTHTDSQKQDT
• Source of smORF: Swiss-Prot
• Function: Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}.
• Pubmed ID: 12810954
• Functional Category: Others
• Uniprot ID: Q7VIA0
• ORF Length (Amino Acid): 82

Conservation Analysis

No. of Species: 30

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	687718	687966	+	NC_004917.1	Helicobacter hepaticus ATCC 51449
2	1579608	1579844	-	NZ_AP022847.1	Nitrosophilus alvini
3	1665036	1665275	-	NZ_AP022826.1	Nitrosophilus labii
4	1783840	1784079	+	NZ_AP023212.1	Hydrogenimonas urashimensis
5	190385	190627	-	NC_005090.1	Wolinella succinogenes DSM 1740
6	1852844	1853053	-	NZ_CP053833.1	Arcobacter cloacae
7	1142202	1142405	-	NZ_CP032097.1	Arcobacter ellisii
8	1670125	1670370	-	NZ_LN907858.1	Helicobacter typhlonius
9	1877684	1877929	-	NC_007575.1	Sulfurimonas denitrificans DSM 1251
10	2725970	2726200	-	NZ_CP042652.1	Pseudoarcobacter acticola
11	1936567	1936812	+	NZ_AP018676.1	Helicobacter cinaedi
12	309524	309754	+	NZ_CP041406.1	Sulfurimonas paralvinellae
13	1713974	1714204	+	NZ_CP032823.1	Aliarcobacter cryaerophilus ATCC 43158
14	262802	263032	-	NZ_CP031367.1	Aliarcobacter trophiarum LMG 25534
15	1997102	1997326	+	NC_017187.1	Aliarcobacter butzleri ED-1
16	1997346	1997582	+	NC_017187.1	Aliarcobacter butzleri ED-1
17	110729	110956	+	NZ_CP011308.1	Sulfurovum lithotrophicum
18	197827	198048	+	NZ_CP053837.1	Aliarcobacter faecis
19	51160	51384	-	NZ_CP063087.1	Helicobacter winghamensis
20	1496457	1496678	-	NZ_CP012541.1	Campylobacter concisus
21	321647	321877	+	NZ_CP019070.1	Poseidonibacter parvus
22	1851115	1851345	+	NZ_CP036246.2	[Arcobacter] porcinus
23	1851348	1851560	+	NZ_CP036246.2	[Arcobacter] porcinus
24	1555880	1556095	-	NZ_CP010995.1	Campylobacter iguaniorum
25	1752913	1753149	+	NZ_CP032099.1	Aliarcobacter skirrowii CCUG 10374
26	1424391	1424606	-	NZ_CP059443.1	Campylobacter fetus
27	345294	345521	+	NZ_CP053836.1	Halarcobacter ebronensis
28	251553	251789	+	NZ_CP031218.1	Malaciobacter halophilus
29	2391435	2391662	-	NZ_CP032100.1	Arcobacter suis CECT 7833
30	167419	167658	+	NC_014935.1	Nitratifractor salsuginis DSM 16511
31	1004085	1004321	-	NZ_CP007770.1	Campylobacter insulaenigrae NCTC 12927
32	393981	394187	+	NZ_CP053841.1	Campylobacter blaseri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_AP022847.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF05746.17	0.93	28	14.0	same-strand	DALR anticodon binding domain
2	PF00750.21	0.93	28	14.0	same-strand	tRNA synthetases class I (R)
3	PF03485.18	0.73	22	14.5	same-strand	Arginyl tRNA synthetase N terminal domain
4	PF01467.28	0.6	18	2129.0	opposite-strand	Cytidylyltransferase-like
5	PF02410.17	0.6	18	1770.5	opposite-strand	Ribosomal silencing factor during starvation