Result : Q7VGD5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S17 |
| NCBI Accession ID | AE017125.1 |
| Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
| Left | 1334600 |
| Right | 1334866 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGAAAAACAAGCGCATACAAGAGTAATTCAAGGTAAAGTCATCAGTCAAGCGGGAAATAAAAGTATAGTAATTTTGGTAGAGCGGAAAGTTGTTCATAGCAAATATCGTAAGATTGTAAAACGTTTTAAAAAATATACTATACACGATGAGAATCAAAGTGCAAAAATTGGCGATGTGGTAAGTGCCATTGAATGTAAGCCTATTTCTAAAACGAAAGCTTTTAGGTTTAAAGAAATTATTACTGCAGGAGTAGAGCTATGA |
| Sequence | MSEKQAHTRVIQGKVISQAGNKSIVILVERKVVHSKYRKIVKRFKKYTIHDENQSAKIGDVVSAIECKPISKTKAFRFKEIITAGVEL |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_01345}. |
| Pubmed ID | 12810954 |
| Domain | CDD:412327 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7VGD5 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 113
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1334600 | 1334866 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 2 | 586295 | 586561 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 3 | 1268534 | 1268800 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 4 | 661720 | 661986 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 5 | 1173200 | 1173460 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 6 | 1362322 | 1362582 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 7 | 842630 | 842890 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 8 | 129303 | 129563 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 9 | 1393904 | 1394170 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 10 | 68117 | 68383 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 11 | 1612210 | 1612476 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 12 | 1353267 | 1353524 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 13 | 1302218 | 1302481 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 14 | 1867382 | 1867633 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 15 | 1611430 | 1611681 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 16 | 1576482 | 1576703 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 17 | 694816 | 695067 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 18 | 32647 | 32898 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 19 | 70626 | 70877 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 20 | 15486 | 15737 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 21 | 63885 | 64136 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 22 | 59486 | 59737 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 23 | 62125 | 62376 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 24 | 186065 | 186316 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 25 | 61504 | 61755 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 26 | 58474 | 58725 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 27 | 1249446 | 1249697 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 28 | 2047628 | 2047879 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 29 | 1615796 | 1616047 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 30 | 1981559 | 1981810 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 31 | 424376 | 424627 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 32 | 2594359 | 2594610 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 33 | 2436822 | 2437073 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 34 | 1686563 | 1686814 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 35 | 1590632 | 1590883 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 36 | 1586242 | 1586487 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 37 | 105439 | 105687 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 38 | 159180 | 159431 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 39 | 2021065 | 2021316 | - | NZ_CP012544.1 | Campylobacter showae |
| 40 | 1850697 | 1850948 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 41 | 1529750 | 1529995 | - | NC_012115.1 | Nautilia profundicola AmH |
| 42 | 345840 | 346085 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 43 | 68638 | 68889 | + | NZ_CP012543.1 | Campylobacter rectus |
| 44 | 1782566 | 1782817 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 45 | 103989 | 104234 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 46 | 109726 | 109944 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 47 | 38133 | 38378 | + | NZ_CP059443.1 | Campylobacter fetus |
| 48 | 938436 | 938657 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 49 | 1481635 | 1481886 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 50 | 215815 | 216060 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 51 | 2139432 | 2139653 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 52 | 889500 | 889721 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 53 | 878135 | 878356 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 54 | 726947 | 727198 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 55 | 935931 | 936152 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 56 | 155681 | 155902 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 57 | 727967 | 728188 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 58 | 1736707 | 1736958 | - | NZ_CP012541.1 | Campylobacter concisus |
| 59 | 173684 | 173929 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 60 | 197085 | 197303 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 61 | 950336 | 950557 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 62 | 1671044 | 1671295 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 63 | 844506 | 844727 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 64 | 1612570 | 1612821 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 65 | 814884 | 815105 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 66 | 869667 | 869888 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 67 | 1526994 | 1527239 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 68 | 911787 | 912008 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 69 | 1059723 | 1059944 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 70 | 1832037 | 1832288 | - | NZ_CP053826.1 | Campylobacter curvus |
| 71 | 640210 | 640461 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 72 | 932167 | 932388 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 73 | 946276 | 946530 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 74 | 787343 | 787564 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 75 | 952524 | 952745 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 76 | 611420 | 611671 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 77 | 92113 | 92358 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 78 | 975585 | 975806 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 79 | 572633 | 572884 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 80 | 675546 | 675767 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 81 | 975277 | 975528 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 82 | 1088171 | 1088392 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 83 | 307993 | 308208 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 84 | 414436 | 414693 | + | NZ_CP025120.1 | Kangiella profundi |
| 85 | 2217958 | 2218215 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 86 | 1382589 | 1382825 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 87 | 468487 | 468744 | + | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 88 | 472117 | 472374 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 89 | 1388362 | 1388625 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 90 | 900233 | 900499 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 91 | 2476727 | 2476984 | + | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 92 | 2394061 | 2394318 | + | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 93 | 442171 | 442428 | + | NZ_CP015121.1 | Acinetobacter baumannii |
| 94 | 476389 | 476646 | + | NZ_CP065820.1 | Acinetobacter seifertii |
| 95 | 458573 | 458830 | + | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 96 | 237460 | 237711 | + | NZ_CP028897.1 | Dongshaea marina |
| 97 | 2726803 | 2727060 | - | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 98 | 447188 | 447445 | + | NZ_CP053391.1 | Acinetobacter lactucae |
| 99 | 331084 | 331344 | + | NZ_AP018933.1 | Zymobacter palmae |
| 100 | 1491629 | 1491859 | - | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 101 | 454670 | 454927 | + | NZ_CP024632.1 | Acinetobacter junii |
| 102 | 492893 | 493150 | - | NZ_CP012808.1 | Acinetobacter equi |
| 103 | 408145 | 408402 | + | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 104 | 3535303 | 3535560 | + | NZ_CP041970.1 | Acinetobacter dispersus |
| 105 | 3130059 | 3130316 | - | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 106 | 808776 | 809033 | - | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 107 | 806670 | 806927 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 108 | 442338 | 442559 | + | NZ_CP013236.1 | Collimonas pratensis |
| 109 | 329943 | 330164 | + | NZ_CP013235.1 | Collimonas arenae |
| 110 | 716484 | 716705 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 111 | 360174 | 360431 | + | NZ_CP024963.1 | Entomoplasma luminosum |
| 112 | 339738 | 339995 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 113 | 162926 | 163183 | + | NZ_LS991954.1 | Mycoplasma putrefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004917.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00203.23 | 0.96 | 108 | 1684.5 | same-strand | Ribosomal protein S19 |
| 2 | PF00237.21 | 0.98 | 111 | 1329 | same-strand | Ribosomal protein L22p/L17e |
| 3 | PF00189.22 | 0.96 | 109 | 613 | same-strand | Ribosomal protein S3, C-terminal domain |
| 4 | PF07650.19 | 0.98 | 111 | 614 | same-strand | KH domain |
| 5 | PF00252.20 | 0.96 | 109 | 193 | same-strand | Ribosomal protein L16p/L10e |
| 6 | PF00831.25 | 1.0 | 113 | 10 | same-strand | Ribosomal L29 protein |
| 7 | PF00238.21 | 0.99 | 112 | 0.0 | same-strand | Ribosomal protein L14p/L23e |
| 8 | PF00467.31 | 0.94 | 106 | 368.0 | same-strand | KOW motif |
| 9 | PF00673.23 | 0.99 | 112 | 608.0 | same-strand | ribosomal L5P family C-terminus |
| 10 | PF00281.21 | 0.99 | 112 | 608.0 | same-strand | Ribosomal protein L5 |
| 11 | PF00253.23 | 0.86 | 97 | 1158 | same-strand | Ribosomal protein S14p/S29e |
| 12 | PF00410.21 | 0.99 | 112 | 1356.0 | same-strand | Ribosomal protein S8 |
++ More..