Result : Q7VFW0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | |
| Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MAHTAFETSLDTLLEEPKMYRVLLLNDDWTAMDFVARILMEVFDKTSDEATAITLKIHNDGKGVCGIYTYDIAELKMQIVSQMAKQHGYPLRVITEEMP |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | 12810954 |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | Q7VFW0 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 163
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1497586 | 1497885 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 2 | 1661263 | 1661580 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 3 | 426943 | 427242 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 4 | 1307664 | 1307960 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 5 | 1595319 | 1595624 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 6 | 2003786 | 2004094 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 7 | 2458668 | 2458931 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 8 | 2148805 | 2149047 | + | NZ_CP061800.1 | Desulfonema magnum |
| 9 | 1900039 | 1900281 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 10 | 2592603 | 2592866 | - | NC_017964.1 | Advenella kashmirensis WT001 |
| 11 | 2164501 | 2164758 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 12 | 1814004 | 1814267 | + | NZ_CP003915.1 | Advenella mimigardefordensis DPN7 |
| 13 | 2172367 | 2172624 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 14 | 2222928 | 2223185 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 15 | 1106131 | 1106406 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 16 | 332950 | 333255 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 17 | 1973610 | 1973882 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 18 | 2048343 | 2048642 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 19 | 372291 | 372590 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 20 | 1201802 | 1202104 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 21 | 807651 | 807962 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 22 | 1725318 | 1725563 | + | NZ_CP046415.1 | Guyparkeria halophila |
| 23 | 1456168 | 1456467 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 24 | 2238248 | 2238505 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 25 | 2518876 | 2519184 | + | NZ_CP026328.2 | Acidithiobacillus caldus |
| 26 | 1670934 | 1671230 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 27 | 2020633 | 2020932 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 28 | 2443294 | 2443593 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 29 | 2284947 | 2285204 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 30 | 1801615 | 1801914 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 31 | 1680896 | 1681138 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 32 | 2376897 | 2377160 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 33 | 453044 | 453286 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 34 | 3527907 | 3528149 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 35 | 488654 | 488929 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 36 | 2264131 | 2264430 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 37 | 298605 | 298847 | - | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 38 | 951995 | 952237 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 39 | 1076574 | 1076816 | - | NZ_CP012943.1 | Ralstonia solanacearum |
| 40 | 2794316 | 2794558 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 41 | 775279 | 775587 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
| 42 | 2410841 | 2411140 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 43 | 2179525 | 2179767 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 44 | 2142826 | 2143125 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 45 | 2485016 | 2485315 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 46 | 1851503 | 1851778 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 47 | 1554112 | 1554411 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 48 | 2149428 | 2149727 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 49 | 1469821 | 1470120 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 50 | 2556079 | 2556378 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 51 | 1251321 | 1251563 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 52 | 981834 | 982076 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 53 | 1427677 | 1427973 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 54 | 1037293 | 1037535 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 55 | 3715563 | 3715805 | - | NZ_CP062803.1 | Cupriavidus basilensis |
| 56 | 801163 | 801462 | - | NZ_CP047165.1 | Pelistega ratti |
| 57 | 314558 | 314872 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 58 | 835526 | 835837 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 59 | 186905 | 187147 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 60 | 3261788 | 3262102 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 61 | 2622866 | 2623108 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 62 | 3914202 | 3914444 | - | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 63 | 685372 | 685620 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
| 64 | 911998 | 912312 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 65 | 664872 | 665114 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 66 | 2289771 | 2290070 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 67 | 133049 | 133291 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 68 | 598364 | 598606 | + | NC_021287.1 | Caballeronia insecticola |
| 69 | 3024853 | 3025095 | - | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 70 | 3307169 | 3307411 | - | NZ_CP039287.1 | Cupriavidus necator H16 |
| 71 | 3270392 | 3270637 | - | NZ_CP020121.1 | Comamonas kerstersii |
| 72 | 1053098 | 1053340 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 73 | 614375 | 614635 | + | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 74 | 3487120 | 3487362 | + | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 75 | 3198881 | 3199123 | - | NZ_CP024934.1 | Paraburkholderia graminis |
| 76 | 3230320 | 3230562 | - | NZ_CP024941.1 | Paraburkholderia terricola |
| 77 | 1989351 | 1989593 | + | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 78 | 1319480 | 1319722 | - | NZ_CP031467.1 | Paraburkholderia caffeinilytica |
| 79 | 3996130 | 3996372 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 80 | 31139 | 31381 | + | NZ_CP017561.1 | Paraburkholderia sprentiae WSM5005 |
| 81 | 2134101 | 2134343 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 82 | 877142 | 877384 | + | NC_007651.1 | Burkholderia thailandensis E264 |
| 83 | 801248 | 801490 | - | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 84 | 2439573 | 2439818 | - | NZ_CP021455.1 | Comamonas serinivorans |
| 85 | 612975 | 613217 | + | NZ_CP009795.1 | Burkholderia dolosa AU0158 |
| 86 | 2836647 | 2836889 | - | NZ_CP009832.1 | Burkholderia multivorans ATCC BAA-247 |
| 87 | 1232709 | 1232951 | + | NZ_CP009727.1 | Burkholderia mallei |
| 88 | 2799357 | 2799599 | - | NZ_CP013398.1 | Burkholderia seminalis |
| 89 | 2869450 | 2869692 | - | NZ_CP013401.1 | Burkholderia metallica |
| 90 | 566531 | 566773 | - | NZ_CP011503.1 | Burkholderia pyrrocinia |
| 91 | 2872899 | 2873141 | - | NZ_CP013450.1 | Burkholderia cenocepacia |
| 92 | 2941661 | 2941903 | - | NZ_CP045235.1 | Burkholderia cepacia |
| 93 | 2968352 | 2968594 | - | NC_007510.1 | Burkholderia lata |
| 94 | 3013734 | 3013976 | - | NZ_CP013459.1 | Burkholderia stagnalis |
| 95 | 2964197 | 2964454 | - | NZ_CP020737.1 | Paraburkholderia acidophila |
| 96 | 3182094 | 3182336 | - | NZ_CP013414.1 | Burkholderia ubonensis |
| 97 | 798834 | 799076 | - | NZ_CP008781.1 | Burkholderia pseudomallei |
| 98 | 513613 | 513855 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 99 | 949011 | 949313 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 100 | 643572 | 643814 | + | NC_010622.1 | Paraburkholderia phymatum STM815 |
| 101 | 3211233 | 3211493 | - | NZ_CP043575.1 | Comamonas koreensis |
| 102 | 2393436 | 2393693 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 103 | 1726863 | 1727135 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 104 | 1214521 | 1214829 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 105 | 452470 | 452772 | - | NZ_LS483369.1 | Neisseria cinerea |
| 106 | 452431 | 452742 | - | NZ_CP072524.1 | Neisseria sicca |
| 107 | 2733844 | 2734086 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 108 | 1788095 | 1788397 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 109 | 3969550 | 3969792 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 110 | 685215 | 685457 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 111 | 591619 | 591897 | + | NC_008783.1 | Bartonella bacilliformis KC583 |
| 112 | 3197514 | 3197831 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 113 | 1833365 | 1833610 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 114 | 1970303 | 1970584 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 115 | 1956171 | 1956416 | + | NZ_CP051298.1 | Alicycliphilus denitrificans |
| 116 | 1597018 | 1597260 | + | NZ_CP012946.1 | Blastochloris viridis |
| 117 | 871766 | 872023 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 118 | 1706525 | 1706806 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 119 | 1981724 | 1981966 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 120 | 1505853 | 1506170 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 121 | 398805 | 399107 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 122 | 1290476 | 1290718 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 123 | 822447 | 822707 | + | NZ_AP014568.1 | Serpentinomonas raichei |
| 124 | 2087651 | 2087965 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 125 | 1108581 | 1108823 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 126 | 2118470 | 2118712 | + | NC_012968.1 | Methylotenera mobilis JLW8 |
| 127 | 3270857 | 3271102 | + | NZ_CP027669.1 | Simplicispira suum |
| 128 | 824492 | 824734 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 129 | 2313424 | 2313669 | + | NZ_CP060714.1 | Diaphorobacter ruginosibacter |
| 130 | 1017107 | 1017349 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 131 | 1330886 | 1331128 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 132 | 2333601 | 2333918 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 133 | 767190 | 767432 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 134 | 893448 | 893693 | + | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 135 | 1991076 | 1991348 | + | NZ_LT906482.1 | Eikenella corrodens |
| 136 | 2098375 | 2098635 | - | NZ_CP054840.1 | Acidovorax antarcticus |
| 137 | 1313685 | 1314005 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 138 | 948323 | 948574 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 139 | 894924 | 895226 | + | NZ_CP059564.1 | Alysiella filiformis |
| 140 | 1076814 | 1077122 | + | NZ_CP009056.1 | Frischella perrara |
| 141 | 1897907 | 1898149 | + | NZ_CP028897.1 | Dongshaea marina |
| 142 | 293389 | 293631 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 143 | 739735 | 739977 | - | NZ_CP021081.1 | Deinococcus ficus |
| 144 | 119332 | 119574 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 145 | 1923724 | 1923966 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 146 | 758390 | 758689 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 147 | 1040211 | 1040453 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 148 | 2597116 | 2597418 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 149 | 2882472 | 2882735 | - | NZ_CP060414.1 | Neisseria musculi |
| 150 | 1029658 | 1029900 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 151 | 1054525 | 1054767 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 152 | 1997142 | 1997390 | + | NZ_CP016211.1 | Minicystis rosea |
| 153 | 1728543 | 1728791 | + | NZ_CP019239.1 | Rhodoferax saidenbachensis |
| 154 | 801849 | 802148 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 155 | 3084639 | 3084881 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 156 | 2661599 | 2661901 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 157 | 1933579 | 1933824 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 158 | 627509 | 627754 | - | NZ_CP014234.1 | Moraxella osloensis |
| 159 | 1876156 | 1876404 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 160 | 3049436 | 3049684 | - | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 161 | 1076931 | 1077188 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 162 | 977966 | 978208 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 163 | 1741318 | 1741560 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004917.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07724.16 | 1.0 | 163 | 2 | same-strand | AAA domain (Cdc48 subfamily) |
| 2 | PF17871.3 | 0.98 | 160 | 2.0 | same-strand | AAA lid domain |
| 3 | PF00004.31 | 1.0 | 163 | 2.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 4 | PF07728.16 | 0.99 | 162 | 2 | same-strand | AAA domain (dynein-related subfamily) |
| 5 | PF10431.11 | 0.99 | 162 | 2.0 | same-strand | C-terminal, D2-small domain, of ClpB protein |
| 6 | PF02861.22 | 0.9 | 147 | 3 | same-strand | Clp amino terminal domain, pathogenicity island component |
++ More..