Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L31 |
NCBI Accession ID | AE017126.1 |
Organism | Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) |
Left | 1549450 |
Right | 1549734 |
Strand | - |
Nucleotide Sequence | ATGCCCAAAAAAGATATACACCCTAATTGGTATCCAGATGCAAAGGTTATTTGCAATGGAGAGGTCGTTATGACTACTGGCTCGACTCAACCTGAGATTCATGTTGATGTTTGGAGTGGAAATCATCCATTCTTTACCGGCACTCAAAAAATTCTTGATACTGAAGGTAGGGTGGATCGCTTTATGCGTAAATATGGCATGGCTAATCCCGATGAAGATAGCACTAAGAATACAAAGTCATCTAAAAAAGAAACTTCTGAGGATTCATCATCAAAGGGGTCCTAA |
Sequence | MPKKDIHPNWYPDAKVICNGEVVMTTGSTQPEIHVDVWSGNHPFFTGTQKILDTEGRVDRFMRKYGMANPDEDSTKNTKSSKKETSEDSSSKGS |
Source of smORF | Swiss-Prot |
Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
Pubmed ID | 12917486 |
Domain | CDD:412343 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q7V9Y9 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1549450 | 1549734 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
2 | 5479918 | 5480169 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
3 | 4152417 | 4152668 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
4 | 4569861 | 4570106 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
5 | 3776290 | 3776520 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
6 | 3750032 | 3750283 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
7 | 1935213 | 1935443 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
8 | 5450192 | 5450434 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
9 | 2182593 | 2182832 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
10 | 3406006 | 3406248 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
11 | 4480604 | 4480840 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
12 | 205590 | 205841 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
13 | 50980 | 51273 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
14 | 2680829 | 2681062 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
15 | 163080 | 163313 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
16 | 2460354 | 2460629 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
17 | 88195 | 88470 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
18 | 849053 | 849304 | - | NC_014221.1 | Truepera radiovictrix DSM 17093 |
19 | 815659 | 815895 | - | NC_012526.1 | Deinococcus deserti VCD115 |
20 | 1072653 | 1072889 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
21 | 740646 | 740882 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03462.20 | 0.67 | 14 | 102.0 | same-strand | PCRF domain |
2 | PF00472.22 | 0.67 | 14 | 102.0 | same-strand | RF-1 domain |
3 | PF00380.21 | 0.81 | 17 | 91 | same-strand | Ribosomal protein S9/S16 |
4 | PF00572.20 | 0.81 | 17 | 504 | same-strand | Ribosomal protein L13 |
5 | PF01416.22 | 0.81 | 17 | 1024 | same-strand | tRNA pseudouridine synthase |
6 | PF01196.21 | 0.81 | 17 | 1904 | same-strand | Ribosomal protein L17 |
7 | PF03118.17 | 0.81 | 17 | 2342 | same-strand | Bacterial RNA polymerase, alpha chain C terminal domain |
8 | PF01000.28 | 0.81 | 17 | 2342 | same-strand | RNA polymerase Rpb3/RpoA insert domain |
9 | PF01193.26 | 0.81 | 17 | 2342 | same-strand | RNA polymerase Rpb3/Rpb11 dimerisation domain |