Protein Information |
Information Type | Description |
---|---|
Protein name | Protein PsbN |
NCBI Accession ID | BX548175.1 |
Organism | Prochlorococcus marinus (strain MIT 9313) |
Left | 1943430 |
Right | 1943576 |
Strand | + |
Nucleotide Sequence | GTGATGGAAAACTCCTCCTCCGAGACCTACTCCCTGCTCATTGCCATGGTCACCATCACCTTCGGGCTGACCGGATACGGGCTCTACACAGCTTTTGGTCCTCCCTCAAAAGAACTCGAAGACCCCTTTGAAGAACACGAAGACTGA |
Sequence | MMENSSSETYSLLIAMVTITFGLTGYGLYTAFGPPSKELEDPFEEHED |
Source of smORF | Swiss-Prot |
Function | May play a role in photosystem I and II biogenesis. {ECO:0000255|HAMAP-Rule:MF_00293}. |
Pubmed ID | 12917642 |
Domain | CDD:421568 |
Functional Category | Others |
Uniprot ID | Q7V4V1 |
ORF Length (Amino Acid) | 48 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3310931 | 3311062 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
2 | 2615953 | 2616084 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
3 | 3945254 | 3945385 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
4 | 5749984 | 5750118 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
5 | 3301894 | 3302025 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
6 | 3303077 | 3303208 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01074.24 | 0.8 | 4 | 110 | opposite-strand | Glycosyl hydrolases family 38 N-terminal domain |
2 | PF07748.15 | 0.8 | 4 | 110 | opposite-strand | Glycosyl hydrolases family 38 C-terminal domain |
3 | PF09261.13 | 0.8 | 4 | 110 | opposite-strand | Alpha mannosidase middle domain |
4 | PF17677.3 | 0.6 | 3 | 110 | opposite-strand | Glycosyl hydrolases family 38 C-terminal beta sandwich domain |
5 | PF00737.22 | 0.6 | 3 | 85 | opposite-strand | Photosystem II 10 kDa phosphoprotein |
6 | PF02416.18 | 0.6 | 3 | 513 | opposite-strand | mttA/Hcf106 family |