Result : Q7V4H6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NAD(P)H-quinone oxidoreductase subunit O (EC 7.1.1.-) (NAD(P)H dehydrogenase I subunit O) (NDH-1 subunit O) (NDH-O) |
| NCBI Accession ID | BX548175.1 |
| Organism | Prochlorococcus marinus (strain MIT 9313) |
| Left | 2084892 |
| Right | 2085137 |
| Strand | + |
| Nucleotide Sequence | ATGGCCGAAACATCTGCACCAGCAAAGGCCACGGCAGCCCTCAAAAAAGGAGCCCTTGTTCGGGTCAATAGGCACGCCTTTAGCAGCAGCACTGAAGCAGCGGCCAGTGATCCTTCTCCCCCCGACTACATTTTCGAAGGTCCAGGTGAACTGCTGGCCGTCAAAGAGGGCTATGGGCAAGTGCGCTGGCGCATGCCTGTTCCGGACGTGTGGCTAAGGATCGATCAGCTGGAACCCTTCTCATGA |
| Sequence | MAETSAPAKATAALKKGALVRVNRHAFSSSTEAAASDPSPPDYIFEGPGELLAVKEGYGQVRWRMPVPDVWLRIDQLEPFS |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. {ECO:0000255|HAMAP-Rule:MF_01354}. |
| Pubmed ID | 12917642 |
| Domain | CDD:403201 |
| Functional Category | Others |
| Uniprot ID | Q7V4H6 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2872407 | 2872652 | - | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 2 | 143921 | 144181 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 3 | 2132462 | 2132704 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 4 | 3327912 | 3328130 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 5 | 2422722 | 2422940 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 6 | 2073398 | 2073616 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 7 | 777203 | 777421 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
++ More..