| Protein name |
Photosystem II reaction center X protein |
| NCBI Accession ID |
|
| Organism |
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4) |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
|
| Sequence |
MIQISNLILAADVSPEVAGSSGFNMIASFFAAALLIVIPAAAFLIFVSQKDSLERTSATRRR |
| Source of smORF |
Swiss-Prot |
| Function |
Involved in the binding and/or turnover of quinones at the Q(B) site of Photosystem II. {ECO:0000255|HAMAP-Rule:MF_01388}. |
| Pubmed ID |
12917642
|
| Domain |
CDD:420068 |
| Functional Category |
Others |
| Uniprot ID |
Q7V3L3
|
| ORF Length (Amino Acid) |
62 |