Protein Information |
Information Type | Description |
---|---|
Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
NCBI Accession ID | BX548174.1 |
Organism | Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4) |
Left | 227987 |
Right | 228280 |
Strand | + |
Nucleotide Sequence | ATGAAACGAATTAGTAGTGATGAAGTTAAAAAAGTAGCACAATTAGCAAGACTAGAACTAAATGAGAGTGAGATTAATCAGCATGCAGAACAGTTAGAAAAAATTTTGGAATATATTAAACAACTTGAGAAAATTAATACCGAGGATATTCCATGCACTACTAGAGCTATAGAAGTGGTCAATGTATTGAGAAAAGATGAAAAGAAAAACTATGAAAATTCGGAGGAAATTTTAGATTTGGCGCCTTCAAGAGAAAATAAATTTTTCAAAGTGCCAAAAATTATTAATGAATAG |
Sequence | MKRISSDEVKKVAQLARLELNESEINQHAEQLEKILEYIKQLEKINTEDIPCTTRAIEVVNVLRKDEKKNYENSEEILDLAPSRENKFFKVPKIINE |
Source of smORF | Swiss-Prot |
Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
Pubmed ID | 12917642 |
Domain | CDD:412411 |
Functional Category | Others |
Uniprot ID | Q7V354 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 260894 | 261187 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
2 | 3176511 | 3176804 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
3 | 4432522 | 4432764 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
4 | 1841500 | 1841793 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
5 | 7675338 | 7675577 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
6 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
7 | 3488544 | 3488813 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
8 | 3669894 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00515.30 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |
2 | PF07719.19 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |
3 | PF13414.8 | 0.62 | 5 | 129 | same-strand | TPR repeat |
4 | PF13424.8 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |