Result : Q7V354
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | BX548174.1 |
| Organism | Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4) |
| Left | 227987 |
| Right | 228280 |
| Strand | + |
| Nucleotide Sequence | ATGAAACGAATTAGTAGTGATGAAGTTAAAAAAGTAGCACAATTAGCAAGACTAGAACTAAATGAGAGTGAGATTAATCAGCATGCAGAACAGTTAGAAAAAATTTTGGAATATATTAAACAACTTGAGAAAATTAATACCGAGGATATTCCATGCACTACTAGAGCTATAGAAGTGGTCAATGTATTGAGAAAAGATGAAAAGAAAAACTATGAAAATTCGGAGGAAATTTTAGATTTGGCGCCTTCAAGAGAAAATAAATTTTTCAAAGTGCCAAAAATTATTAATGAATAG |
| Sequence | MKRISSDEVKKVAQLARLELNESEINQHAEQLEKILEYIKQLEKINTEDIPCTTRAIEVVNVLRKDEKKNYENSEEILDLAPSRENKFFKVPKIINE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 12917642 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | Q7V354 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 260894 | 261187 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 2 | 3176511 | 3176804 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 3 | 4432522 | 4432764 | - | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 4 | 1841500 | 1841793 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 5 | 7675338 | 7675577 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 6 | 4025855 | 4026142 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 7 | 3488544 | 3488813 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 8 | 3669894 | 3670133 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP042326.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00515.30 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |
| 2 | PF07719.19 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |
| 3 | PF13414.8 | 0.62 | 5 | 129 | same-strand | TPR repeat |
| 4 | PF13424.8 | 0.62 | 5 | 129 | same-strand | Tetratricopeptide repeat |
++ More..