ProsmORF-pred
Result : Q7V1W2
Protein Information
Information Type Description
Protein name Cytochrome b6-f complex subunit 8 (Cytochrome b6-f complex subunit PetN) (Cytochrome b6-f complex subunit VIII)
NCBI Accession ID BX548174.1
Organism Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Left 702343
Right 702447
Strand +
Nucleotide Sequence ATGATGATTTTTCAGATAGGTTGGGCTGCTTTAGCAGCAATTTTTACTTTTTCAATTGCTATGGTTGTTTGGGGCAGAAATGGTGACGGTTCTATTGATATATGA
Sequence MMIFQIGWAALAAIFTFSIAMVVWGRNGDGSIDI
Source of smORF Swiss-Prot
Function Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. {ECO:0000255|HAMAP-Rule:MF_00395}.
Pubmed ID 12917642
Domain CDD:134722
Functional Category Others
Uniprot ID Q7V1W2
ORF Length (Amino Acid) 34
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 25
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 834283 834384 + NC_005042.1 Prochlorococcus marinus subsp. marinus str. CCMP1375
2 659768 659869 - NC_019675.1 Cyanobium gracile PCC 6307
3 4419195 4419284 + NZ_AP014638.1 Leptolyngbya boryana IAM M-101
4 7253920 7254009 - NC_019693.1 Oscillatoria acuminata PCC 6304
5 5508692 5508781 + NZ_CP024785.1 Nostoc flagelliforme CCNUN1
6 1966643 1966732 - NC_010628.1 Nostoc punctiforme PCC 73102
7 1387458 1387547 - NZ_CP054698.1 Nostoc edaphicum CCNP1411
8 2732775 2732864 - NZ_CP031941.1 Nostoc sphaeroides
9 2785730 2785819 - NZ_CP047242.1 Trichormus variabilis 0441
10 544689 544778 + NC_019748.1 Stanieria cyanosphaera PCC 7437
11 3042743 3042832 - NC_014501.1 Gloeothece verrucosa PCC 7822
12 2361098 2361187 - NC_010296.1 Microcystis aeruginosa NIES-843
13 1139451 1139540 - NC_011729.1 Gloeothece citriformis PCC 7424
14 3959885 3959974 + NC_019753.1 Crinalium epipsammum PCC 9333
15 4575156 4575245 - NC_009925.1 Acaryochloris marina MBIC11017
16 2014130 2014219 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
17 4951431 4951520 - NC_019689.1 Pleurocapsa sp. PCC 7327
18 1765113 1765202 - NZ_CP021983.2 Halomicronema hongdechloris C2206
19 1952224 1952313 - NC_019780.1 Dactylococcopsis salina PCC 8305
20 2494934 2495023 + NC_019776.1 Cyanobacterium aponinum PCC 10605
21 2694289 2694378 - NZ_CP042326.1 Euhalothece natronophila Z-M001
22 3908907 3908996 - NC_005125.1 Gloeobacter violaceus PCC 7421
23 852621 852710 - NC_004113.1 Thermosynechococcus vestitus BP-1
24 1106224 1106313 + NZ_AP018202.1 Thermostichus vulcanus NIES-2134
25 737437 737526 - NZ_CP018092.1 Synechococcus lividus PCC 6715
++ More..