Result : Q7UP93
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | BX294145.1 |
| Organism | Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) |
| Left | 127968 |
| Right | 128240 |
| Strand | - |
| Nucleotide Sequence | GTGCTCGAAGAACTGAAAGAAGAAGAAATCGTCAACAAGATCGGTGGCCGTTTCAAACTCAGCACCTTGATCCAGAAACGTCTCGTCCAGCTCAACCAGGGCAGCCGAGCGTTGGTCAGCGTGGACACGCACGACAAAATGTCGATCGTGTTGCAAGAAATTGTCCAGGACAAGATCTTTCTGAACATGGAAAACGAGATCGAAACGGTCGACGACCTCGATGCCATCGTTGCCGCTAGCGAAGCTCCTGAACTGGATCCTTCGGACCTGTAA |
| Sequence | MLEELKEEEIVNKIGGRFKLSTLIQKRLVQLNQGSRALVSVDTHDKMSIVLQEIVQDKIFLNMENEIETVDDLDAIVAASEAPELDPSDL |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 12835416 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | Q7UP93 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3764268 | 3764540 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 2 | 2846204 | 2846467 | + | NZ_CP036292.1 | Rosistilla oblonga |
| 3 | 706219 | 706482 | - | NZ_CP042914.1 | Roseimaritima ulvae |
| 4 | 4034330 | 4034593 | - | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 5 | 4368286 | 4368552 | + | NZ_CP036289.1 | Bremerella volcania |
| 6 | 4975844 | 4976110 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 7 | 9221052 | 9221324 | - | NZ_CP042997.1 | Aquisphaera giovannonii |
| 8 | 6710911 | 6711171 | + | NZ_CP036274.1 | Anatilimnocola aggregata |
| 9 | 2697116 | 2697394 | - | NZ_CP036353.1 | Gimesia maris |
| 10 | 5556550 | 5556810 | + | NZ_CP042912.1 | Mariniblastus fucicola |
| 11 | 2334163 | 2334426 | - | NZ_AP021861.1 | Lacipirellula parvula |
| 12 | 236281 | 236571 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 13 | 3607181 | 3607441 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 14 | 2665767 | 2666027 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 15 | 4415323 | 4415598 | + | NZ_CP036275.1 | Maioricimonas rarisocia |
| 16 | 5416215 | 5416487 | + | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 17 | 5989293 | 5989562 | - | NZ_CP036276.1 | Symmachiella dynata |
| 18 | 54118 | 54372 | + | NZ_CP018477.1 | Thermogutta terrifontis |
| 19 | 632067 | 632303 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005027.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02441.21 | 0.89 | 17 | 39 | same-strand | Flavoprotein |
| 2 | PF00625.23 | 1.0 | 19 | -7 | same-strand | Guanylate kinase |
| 3 | PF13238.8 | 0.63 | 12 | -3 | same-strand | AAA domain |
| 4 | PF03755.15 | 1.0 | 19 | 666 | same-strand | YicC-like family, N-terminal region |
| 5 | PF08340.13 | 1.0 | 19 | 666 | same-strand | Domain of unknown function (DUF1732) |
| 6 | PF03840.16 | 1.0 | 19 | 1656 | same-strand | Preprotein translocase SecG subunit |
| 7 | PF00121.20 | 1.0 | 19 | 2367 | same-strand | Triosephosphate isomerase |
++ More..