Result : Q7UP72
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | |
| Organism | Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MGTKIKTHKGTKKRFRLSAKGKAMHRQSGTSHLAKGLSKKRRRNLRGTTAVAECMEPTIHAALNGHSY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12835416 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7UP72 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3779777 | 3779983 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 2 | 3849634 | 3849828 | - | NZ_CP042914.1 | Roseimaritima ulvae |
| 3 | 2071537 | 2071731 | + | NZ_CP036292.1 | Rosistilla oblonga |
| 4 | 2567093 | 2567296 | - | NZ_CP036433.1 | Lignipirellula cremea |
| 5 | 1477850 | 1478044 | + | NZ_CP042912.1 | Mariniblastus fucicola |
| 6 | 5006776 | 5006979 | - | NZ_CP036291.1 | Pirellulimonas nuda |
| 7 | 5463410 | 5463604 | + | NZ_CP036289.1 | Bremerella volcania |
| 8 | 492683 | 492877 | - | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 9 | 6489493 | 6489696 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 10 | 5211425 | 5211619 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 11 | 1294253 | 1294456 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 12 | 6738692 | 6738886 | - | NZ_CP036274.1 | Anatilimnocola aggregata |
| 13 | 1082806 | 1083000 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_005027.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03483.19 | 0.92 | 12 | 1907.5 | same-strand | B3/4 domain |
| 2 | PF17759.3 | 0.92 | 12 | 1907.5 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
| 3 | PF03484.17 | 0.92 | 12 | 1907.5 | same-strand | tRNA synthetase B5 domain |
| 4 | PF03147.16 | 0.92 | 12 | 1907.5 | same-strand | Ferredoxin-fold anticodon binding domain |
| 5 | PF01409.22 | 0.92 | 12 | 630.5 | same-strand | tRNA synthetases class II core domain (F) |
| 6 | PF02912.20 | 0.92 | 12 | 630.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
| 7 | PF00453.20 | 1.0 | 13 | 135 | same-strand | Ribosomal protein L20 |
++ More..