Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L35 |
NCBI Accession ID | |
Organism | Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MGTKIKTHKGTKKRFRLSAKGKAMHRQSGTSHLAKGLSKKRRRNLRGTTAVAECMEPTIHAALNGHSY |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 12835416 |
Domain | CDD:412354 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q7UP72 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3779777 | 3779983 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
2 | 3849634 | 3849828 | - | NZ_CP042914.1 | Roseimaritima ulvae |
3 | 2071537 | 2071731 | + | NZ_CP036292.1 | Rosistilla oblonga |
4 | 2567093 | 2567296 | - | NZ_CP036433.1 | Lignipirellula cremea |
5 | 1477850 | 1478044 | + | NZ_CP042912.1 | Mariniblastus fucicola |
6 | 5006776 | 5006979 | - | NZ_CP036291.1 | Pirellulimonas nuda |
7 | 5463410 | 5463604 | + | NZ_CP036289.1 | Bremerella volcania |
8 | 492683 | 492877 | - | NC_013720.1 | Pirellula staleyi DSM 6068 |
9 | 6489493 | 6489696 | - | NZ_CP036278.1 | Aeoliella mucimassa |
10 | 5211425 | 5211619 | - | NZ_CP036298.1 | Aureliella helgolandensis |
11 | 1294253 | 1294456 | + | NZ_AP021861.1 | Lacipirellula parvula |
12 | 6738692 | 6738886 | - | NZ_CP036274.1 | Anatilimnocola aggregata |
13 | 1082806 | 1083000 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03483.19 | 0.92 | 12 | 1907.5 | same-strand | B3/4 domain |
2 | PF17759.3 | 0.92 | 12 | 1907.5 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
3 | PF03484.17 | 0.92 | 12 | 1907.5 | same-strand | tRNA synthetase B5 domain |
4 | PF03147.16 | 0.92 | 12 | 1907.5 | same-strand | Ferredoxin-fold anticodon binding domain |
5 | PF01409.22 | 0.92 | 12 | 630.5 | same-strand | tRNA synthetases class II core domain (F) |
6 | PF02912.20 | 0.92 | 12 | 630.5 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
7 | PF00453.20 | 1.0 | 13 | 135 | same-strand | Ribosomal protein L20 |