Result : Q7UMN0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L33 |
| NCBI Accession ID | BX294148.1 |
| Organism | Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) |
| Left | 62901 |
| Right | 63065 |
| Strand | + |
| Nucleotide Sequence | ATGTCCAAGAGCAAGAAAAAAGCAGAAACCATTTTCCTGGTCTGCGAAGAAACCGGACAATACAACTACACCCTCCGCAAAAAGCCTGGTGGGGAAAAGCTTCGCTTGAAGAAGTACAACCCCAACTTGCGCAAGCACACCTGGCACGCTGAAAAGAAAAAGTAA |
| Sequence | MSKSKKKAETIFLVCEETGQYNYTLRKKPGGEKLRLKKYNPNLRKHTWHAEKKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00383. Profile Description: Ribosomal protein L33. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 12835416 |
| Domain | CDD:412348 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7UMN0 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4638301 | 4638465 | + | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 2 | 8048816 | 8048980 | + | NZ_CP042914.1 | Roseimaritima ulvae |
| 3 | 918927 | 919091 | - | NZ_CP036289.1 | Bremerella volcania |
| 4 | 3044447 | 3044611 | + | NZ_CP036274.1 | Anatilimnocola aggregata |
| 5 | 1525710 | 1525874 | + | NZ_CP036292.1 | Rosistilla oblonga |
| 6 | 1986438 | 1986572 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 7 | 5701171 | 5701335 | + | NZ_CP042912.1 | Mariniblastus fucicola |
| 8 | 314574 | 314744 | + | NZ_CP018477.1 | Thermogutta terrifontis |
| 9 | 7635570 | 7635734 | + | NZ_CP036433.1 | Lignipirellula cremea |
| 10 | 1203704 | 1203865 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 11 | 2784190 | 2784354 | - | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 12 | 420524 | 420703 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 13 | 409854 | 410033 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 14 | 408404 | 408583 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 15 | 406801 | 406938 | - | NZ_CP044535.1 | Borrelia maritima |
| 16 | 499452 | 499586 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 17 | 6773363 | 6773518 | - | NZ_CP036276.1 | Symmachiella dynata |
| 18 | 408525 | 408704 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 19 | 401726 | 401905 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 20 | 406693 | 406830 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 21 | 408979 | 409116 | - | NZ_CP015796.1 | Borreliella mayonii |
| 22 | 409588 | 409725 | - | NZ_CP028861.1 | Borreliella garinii |
| 23 | 4381444 | 4381584 | - | NZ_CP036275.1 | Maioricimonas rarisocia |
| 24 | 1478078 | 1478233 | + | NZ_CP036299.1 | Planctopirus ephydatiae |
| 25 | 546408 | 546563 | + | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 26 | 50167 | 50325 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 27 | 7645173 | 7645325 | - | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 28 | 966752 | 966931 | + | NC_017080.1 | Phycisphaera mikurensis NBRC 102666 |
| 29 | 571944 | 572093 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 30 | 841073 | 841222 | + | NC_022538.1 | Acholeplasma palmae J233 |
++ More..