Result : Q7UFN3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | |
| Organism | Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSTRSRARKRSRVRSRTRRKDPIFVDGHRPRPMYVDYKDLELLSKMVNRQGRIMGRRKSGCTAASQHAVTAAIKRARFMALLPYVGE |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 12835416 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q7UFN3 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4518400 | 4518663 | + | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 2 | 3469271 | 3469549 | - | NZ_CP042914.1 | Roseimaritima ulvae |
| 3 | 6674270 | 6674533 | - | NZ_CP036292.1 | Rosistilla oblonga |
| 4 | 1375616 | 1375891 | - | NZ_CP036298.1 | Aureliella helgolandensis |
| 5 | 6926705 | 6926980 | - | NZ_CP036433.1 | Lignipirellula cremea |
| 6 | 2158367 | 2158588 | + | NC_013720.1 | Pirellula staleyi DSM 6068 |
| 7 | 1054227 | 1054496 | - | NZ_CP036289.1 | Bremerella volcania |
| 8 | 7867869 | 7868120 | - | NZ_CP036274.1 | Anatilimnocola aggregata |
| 9 | 5439163 | 5439432 | + | NZ_CP042912.1 | Mariniblastus fucicola |
| 10 | 1972756 | 1973001 | - | NZ_CP036278.1 | Aeoliella mucimassa |
| 11 | 1988904 | 1989143 | - | NZ_CP036291.1 | Pirellulimonas nuda |
| 12 | 3779711 | 3779962 | + | NZ_AP021861.1 | Lacipirellula parvula |
| 13 | 5997241 | 5997516 | - | NZ_CP042425.1 | Limnoglobus roseus |
| 14 | 1466535 | 1466777 | - | NC_014962.1 | Isosphaera pallida ATCC 43644 |
| 15 | 1455801 | 1456040 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 16 | 1670534 | 1670773 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 17 | 1690094 | 1690333 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 18 | 884978 | 885217 | + | NZ_LR134293.1 | Streptococcus canis |
| 19 | 1516066 | 1516305 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 20 | 1821641 | 1821880 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 21 | 944273 | 944512 | + | NZ_CP043405.1 | Streptococcus ratti |
++ More..