Result : Q7UCH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Two-component-system connector protein SafA |
| NCBI Accession ID | AE014073.1 |
| Organism | Shigella flexneri |
| Left | 1608707 |
| Right | 1608910 |
| Strand | - |
| Nucleotide Sequence | ATGCATGCGACCACAGTGAAAAACAAAATCACGCAAAGAGATAACTATAAAGAAATCATGTCTGTAATTGTGGTTGTCTTATTACTGACACTTACGTTGATAGCCATTTTTTCGGCAATTGATCAGCTGAGTATTTCAGAAATGGGTCGCATTGCAAGAGATCTTACACATTTCATTATCAATAGTTTGCAAGACTGGAAATAA |
| Sequence | MHATTVKNKITQRDNYKEIMSVIVVVLLLTLTLIAIFSAIDQLSISEMGRIARDLTHFIINSLQDWK |
| Source of smORF | Swiss-Prot |
| Function | Connects the signal transduction between the two-component systems EvgS/EvgA and PhoQ/PhoP, by directly interacting with PhoQ and thus activating the PhoQ/PhoP system, in response to acid stress conditions. {ECO:0000250}. |
| Pubmed ID | 12384590 12704152 |
| Domain | CDD:319116 |
| Functional Category | Others |
| Uniprot ID | Q7UCH6 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1570335 | 1570538 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1583762 | 1583959 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00165.25 | 1.0 | 2 | 71.5 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 2 | PF12833.9 | 1.0 | 2 | 71.5 | same-strand | Helix-turn-helix domain |
| 3 | PF01568.23 | 1.0 | 2 | 248.0 | same-strand | Molydopterin dinucleotide binding domain |
| 4 | PF00419.22 | 1.0 | 2 | 2861 | same-strand | Fimbrial protein |
++ More..