Result : Q7U318
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | AE017125.1 |
| Organism | Helicobacter hepaticus (strain ATCC 51449 / 3B1) |
| Left | 1168356 |
| Right | 1168628 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTTTAGACCTTTGGGAGAGAGAGTTCTCGTAGAACGCGTGGAAGAAGATACTAAAACAAGTTCGGGTATTATTATTCCTGATAATGCTAAAGAAAAACCTCTTATGGGTATAGTAAAGGCAGTAAGTGCTAAAATCAAAGACGACAAAATATTGAAAGAAAATGATAAAGTCGTATTTGGTAAATATAAGGGCGCAGAAATCAAGCTAGATTCAAAGGAGTTTATTGTCCTAGAGCTAGATGATATTTTGGGCGTTATTGAAAAATAA |
| Sequence | MKFRPLGERVLVERVEEDTKTSSGIIIPDNAKEKPLMGIVKAVSAKIKDDKILKENDKVVFGKYKGAEIKLDSKEFIVLELDDILGVIEK |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 12810954 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | Q7U318 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 190
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1168356 | 1168628 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 2 | 1855783 | 1856055 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 3 | 2092211 | 2092483 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 4 | 582498 | 582758 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 5 | 1802286 | 1802561 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 6 | 891475 | 891735 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 7 | 306636 | 306905 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 8 | 1859548 | 1859814 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 9 | 457185 | 457457 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 10 | 758745 | 759011 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 11 | 1029114 | 1029380 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 12 | 971674 | 971940 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 13 | 813647 | 813913 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 14 | 90402 | 90662 | - | NZ_CP063079.1 | Campylobacter peloridis |
| 15 | 1149194 | 1149454 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 16 | 180856 | 181116 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 17 | 561842 | 562111 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 18 | 763342 | 763602 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 19 | 965409 | 965669 | - | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 20 | 2081847 | 2082107 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 21 | 1237637 | 1237897 | - | NZ_CP053826.1 | Campylobacter curvus |
| 22 | 1102428 | 1102688 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 23 | 1305420 | 1305680 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 24 | 1339698 | 1339967 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 25 | 988160 | 988420 | - | NC_012039.1 | Campylobacter lari RM2100 |
| 26 | 941871 | 942131 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 27 | 856089 | 856349 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 28 | 1164817 | 1165077 | - | NZ_CP012541.1 | Campylobacter concisus |
| 29 | 1127003 | 1127263 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 30 | 1025587 | 1025847 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 31 | 1079639 | 1079899 | - | NZ_CP053848.1 | Campylobacter ornithocola |
| 32 | 424793 | 425068 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 33 | 236324 | 236569 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 34 | 851345 | 851605 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 35 | 433116 | 433376 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 36 | 949060 | 949320 | - | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 37 | 635612 | 635872 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 38 | 1401058 | 1401330 | + | NC_012115.1 | Nautilia profundicola AmH |
| 39 | 484566 | 484826 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 40 | 1664189 | 1664446 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 41 | 896178 | 896447 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 42 | 1261530 | 1261790 | - | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 43 | 7116522 | 7116809 | - | NZ_AP021875.1 | Desulfosarcina widdelii |
| 44 | 3226043 | 3226330 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 45 | 535646 | 535903 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 46 | 614684 | 614971 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 47 | 1324450 | 1324707 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 48 | 1346290 | 1346547 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 49 | 1862129 | 1862395 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 50 | 2286407 | 2286697 | - | NZ_CP026100.1 | Caulobacter flavus |
| 51 | 504600 | 504857 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 52 | 4043594 | 4043884 | + | NZ_CP027850.1 | Caulobacter segnis |
| 53 | 877351 | 877611 | + | NZ_CP012543.1 | Campylobacter rectus |
| 54 | 399960 | 400217 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 55 | 543292 | 543582 | - | NZ_CP013002.1 | Caulobacter henricii |
| 56 | 779643 | 779933 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 57 | 458636 | 458896 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 58 | 1620992 | 1621249 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 59 | 846082 | 846372 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 60 | 2445502 | 2445789 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 61 | 6493511 | 6493798 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 62 | 1263048 | 1263308 | - | NZ_CP012544.1 | Campylobacter showae |
| 63 | 5983594 | 5983881 | + | NZ_CP061799.1 | Desulfonema limicola |
| 64 | 786872 | 787129 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 65 | 2446983 | 2447270 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 66 | 3071519 | 3071806 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 67 | 8306020 | 8306310 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 68 | 3793044 | 3793340 | + | NC_010162.1 | Sorangium cellulosum So ce56 |
| 69 | 3230538 | 3230825 | - | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 70 | 3729231 | 3729521 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 71 | 31399 | 31686 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 72 | 1257180 | 1257449 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 73 | 481363 | 481620 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 74 | 3281524 | 3281811 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 75 | 4972259 | 4972549 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 76 | 1929556 | 1929843 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 77 | 7130934 | 7131221 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 78 | 4797237 | 4797524 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 79 | 314454 | 314741 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 80 | 2642461 | 2642748 | - | NZ_CP024199.1 | Thalassospira marina |
| 81 | 2582545 | 2582823 | + | NZ_LR134503.1 | Kaistella jeonii |
| 82 | 173329 | 173613 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 83 | 678400 | 678657 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 84 | 3664908 | 3665195 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 85 | 2681441 | 2681728 | - | NZ_CP004388.1 | Thalassospira xiamenensis M-5 = DSM 17429 |
| 86 | 974497 | 974760 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 87 | 643404 | 643664 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 88 | 3092853 | 3093143 | + | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 89 | 564789 | 565046 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 90 | 2648962 | 2649249 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 91 | 677984 | 678241 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 92 | 1245439 | 1245729 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 93 | 10042025 | 10042315 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 94 | 421703 | 421966 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 95 | 686111 | 686368 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 96 | 257232 | 257549 | + | NZ_CP054621.1 | Azospirillum oryzae |
| 97 | 35373 | 35660 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 98 | 3253761 | 3254048 | - | NZ_CP031555.1 | Thalassospira indica |
| 99 | 476289 | 476579 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 100 | 3965980 | 3966270 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 101 | 567165 | 567422 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 102 | 2538601 | 2538891 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 103 | 3609167 | 3609454 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 104 | 788363 | 788653 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 105 | 183536 | 183826 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 106 | 3715708 | 3715995 | - | NZ_CP004393.1 | Celeribacter indicus |
| 107 | 2766923 | 2767210 | + | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 108 | 221887 | 222174 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 109 | 3295912 | 3296139 | + | NZ_CP053348.1 | Winogradskyella forsetii |
| 110 | 558085 | 558327 | - | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 111 | 632428 | 632685 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 112 | 3078861 | 3079172 | - | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 113 | 2261618 | 2261908 | + | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 114 | 929823 | 930086 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 115 | 1772128 | 1772415 | - | NZ_CP051131.1 | Parasphingopyxis algicola |
| 116 | 699506 | 699796 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 117 | 137796 | 138086 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 118 | 255454 | 255744 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 119 | 2192789 | 2193067 | - | NZ_CP033920.1 | Chryseobacterium carnipullorum |
| 120 | 2068387 | 2068665 | + | NZ_CP022986.1 | Chryseobacterium camelliae |
| 121 | 1058417 | 1058659 | - | NZ_CP033929.1 | Chryseobacterium indoltheticum |
| 122 | 1562683 | 1562973 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 123 | 1460457 | 1460744 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 124 | 2268399 | 2268686 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 125 | 3069338 | 3069625 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 126 | 3483572 | 3483850 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 127 | 3172978 | 3173256 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 128 | 2689703 | 2689981 | + | NZ_LR134441.1 | Kaistella antarctica |
| 129 | 2309526 | 2309792 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 130 | 3873455 | 3873742 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 131 | 623316 | 623606 | - | NZ_CP035503.1 | Rhodoferax sediminis |
| 132 | 3897099 | 3897386 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 133 | 3953031 | 3953273 | - | NZ_CP023049.2 | Chryseobacterium piperi |
| 134 | 2779310 | 2779552 | - | NZ_CP015199.1 | Chryseobacterium glaciei |
| 135 | 1739865 | 1740134 | - | NZ_CP022389.1 | Capnocytophaga canimorsus |
| 136 | 476101 | 476391 | - | NC_011761.1 | Acidithiobacillus ferrooxidans ATCC 23270 |
| 137 | 3902740 | 3903027 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 138 | 2515043 | 2515285 | + | NZ_CP033926.1 | Chryseobacterium joostei |
| 139 | 2865336 | 2865578 | - | NZ_LR215974.1 | Chryseobacterium taihuense |
| 140 | 2472818 | 2473108 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 141 | 1704043 | 1704333 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 142 | 2505990 | 2506280 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 143 | 3345611 | 3345898 | - | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 144 | 1033599 | 1033889 | + | NZ_LT906442.1 | Legionella waltersii |
| 145 | 749936 | 750226 | + | NZ_CP013742.1 | Legionella pneumophila |
| 146 | 2993590 | 2993880 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 147 | 2370013 | 2370240 | - | NZ_CP058595.1 | Costertonia aggregata |
| 148 | 291147 | 291437 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 149 | 1535649 | 1535939 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 150 | 34354 | 34641 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 151 | 714215 | 714478 | + | NZ_CP059443.1 | Campylobacter fetus |
| 152 | 286966 | 287256 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 153 | 559633 | 559899 | + | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 154 | 266151 | 266441 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 155 | 3234740 | 3235030 | + | NZ_LR134374.1 | Legionella spiritensis |
| 156 | 1199863 | 1200126 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 157 | 2126657 | 2126944 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 158 | 9041971 | 9042261 | - | NC_013440.1 | Haliangium ochraceum DSM 14365 |
| 159 | 2729685 | 2729972 | - | NZ_CP011452.2 | Croceibacterium atlanticum |
| 160 | 2432380 | 2432670 | - | NZ_LN681225.1 | Legionella hackeliae |
| 161 | 146297 | 146587 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 162 | 758924 | 759214 | + | NZ_LT906451.1 | Legionella lansingensis |
| 163 | 878162 | 878452 | + | NZ_CP016397.1 | Legionella clemsonensis |
| 164 | 3945434 | 3945721 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 165 | 1063266 | 1063553 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 166 | 3193120 | 3193407 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 167 | 3359541 | 3359816 | + | NZ_CP053351.1 | Winogradskyella schleiferi |
| 168 | 3197595 | 3197885 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 169 | 6125521 | 6125811 | + | NC_008095.1 | Myxococcus xanthus DK 1622 |
| 170 | 1853759 | 1854046 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 171 | 6041142 | 6041432 | + | NZ_CP022203.1 | Corallococcus macrosporus DSM 14697 |
| 172 | 2331055 | 2331345 | - | NZ_CP012109.1 | Myxococcus hansupus |
| 173 | 374232 | 374522 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 174 | 1437805 | 1438077 | + | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 175 | 229446 | 229736 | + | NZ_CP025120.1 | Kangiella profundi |
| 176 | 4823655 | 4823972 | - | NZ_CP042582.1 | Hypericibacter adhaerens |
| 177 | 2572077 | 2572304 | + | NZ_CP041345.1 | Tenuifilum thalassicum |
| 178 | 63250 | 63540 | + | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 179 | 415234 | 415524 | - | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 180 | 4323965 | 4324255 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 181 | 297664 | 297954 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 182 | 2503911 | 2504156 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 183 | 347249 | 347539 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 184 | 1428283 | 1428570 | + | NZ_LR134302.1 | Achromobacter spanius |
| 185 | 205886 | 206176 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 186 | 1313832 | 1314122 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 187 | 638391 | 638666 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 188 | 319311 | 319601 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 189 | 1653186 | 1653425 | - | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 190 | 660031 | 660300 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 191 | 982709 | 982972 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 192 | 770472 | 770777 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 193 | 4984405 | 4984722 | - | NZ_CP042906.1 | Hypericibacter terrae |
| 194 | 677538 | 677855 | - | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004917.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 0.98 | 187 | 42 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..