Protein Information |
Information Type | Description |
---|---|
Protein name | Polyketide biosynthesis acyl-carrier-protein AcpK (ACP-II) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1788469 |
Right | 1788717 |
Strand | + |
Nucleotide Sequence | ATGGATAAACAGAGAATCTTTGAAGTATTAATCACCAATATTTGCGAGGTGCTTCCTGAATTAGACGGACACAGATTTGAGCCTGAAGATCAGTTAGTTGAGCTAGGAGCTGACTCTGTAGACAGAGCTGAAATTATCACGATGGTGCTAGAGGATTTATCGTTAAAAATCCCTCGCATTGAGCTATCCGGGGTGAAAAACATCGGTGAATTAGCTGAGGTGCTTTATGACAAAGTGCAATCTGCCTGA |
Sequence | MDKQRIFEVLITNICEVLPELDGHRFEPEDQLVELGADSVDRAEIITMVLEDLSLKIPRIELSGVKNIGELAEVLYDKVQSA |
Source of smORF | Swiss-Prot |
Function | Involved in some intermediate steps for the synthesis of the antibiotic polyketide bacillaene which is involved in secondary metabolism. {ECO:0000269|Pubmed:16757561, ECO:0000269|Pubmed:17234808}. |
Pubmed ID | 9384377 11489886 16757561 17190806 17234808 |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | Q7PC63 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1788469 | 1788717 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1757154 | 1757402 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 189575 | 189823 | - | NZ_CP029364.1 | Bacillus halotolerans |
4 | 5125440 | 5125688 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
5 | 2215645 | 2215893 | - | NZ_CP011937.1 | Bacillus velezensis |
6 | 1747440 | 1747688 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
7 | 4671468 | 4671713 | - | NZ_AP018449.1 | Methylomusa anaerophila |
8 | 61899 | 62144 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
9 | 3979150 | 3979395 | - | NZ_CP051486.1 | Streptomyces pratensis |
10 | 246446 | 246694 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
11 | 4370752 | 4371000 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
12 | 2249867 | 2250115 | + | NZ_CP013984.1 | Bacillus inaquosorum |
13 | 734743 | 734982 | - | NZ_CP009728.1 | Burkholderia mallei |
14 | 1332415 | 1332654 | + | NZ_CP008782.1 | Burkholderia pseudomallei |
15 | 4808375 | 4808614 | - | NC_008095.1 | Myxococcus xanthus DK 1622 |
16 | 6773524 | 6773769 | - | NC_013132.1 | Chitinophaga pinensis DSM 2588 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00698.23 | 0.75 | 12 | 2308 | same-strand | Acyl transferase domain |
2 | PF00109.28 | 0.94 | 15 | 2846.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
3 | PF02801.24 | 0.94 | 15 | 2846.5 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
4 | PF01154.19 | 0.88 | 14 | 1227.0 | same-strand | Hydroxymethylglutaryl-coenzyme A synthase N terminal |
5 | PF00378.22 | 0.81 | 13 | 2285.5 | same-strand | Enoyl-CoA hydratase/isomerase |
6 | PF08659.12 | 0.75 | 12 | 3895 | same-strand | KR domain |
7 | PF00550.27 | 0.88 | 14 | 4089 | same-strand | Phosphopantetheine attachment site |
8 | PF16197.7 | 0.62 | 10 | 4115 | same-strand | Ketoacyl-synthetase C-terminal extension |
9 | PF00106.27 | 0.62 | 10 | 4090 | same-strand | short chain dehydrogenase |