ProsmORF-pred
Result : Q7NUK7
Protein Information
Information Type Description
Protein name Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit)
NCBI Accession ID AE016825.1
Organism Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Left 2912974
Right 2913207
Strand +
Nucleotide Sequence ATGGCAAAAGCCGCCAAAGCGCCGGCCAGCTTCGAAACCGCGCTGGCCCAGCTGGAGGACATCATCCAGGCGATGGACAGCGGCGACATGCCGCTGGAAACAGCCCTTGCCTCCTACAAGCAAGGCACCGAATTGATCAAGTTCTGCCAGGGCAAGCTGGCCGACGCGGAACAGCAGCTGAAAATCCTGGAAAACAACGAACTGAAGACGCTGGATCTGCCCAATGGCCAATGA
Sequence MAKAAKAPASFETALAQLEDIIQAMDSGDMPLETALASYKQGTELIKFCQGKLADAEQQLKILENNELKTLDLPNGQ
Source of smORF Swiss-Prot
Function Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}.
Pubmed ID 14500782
Domain CDD:412547
Functional Category Others
Uniprot ID Q7NUK7
ORF Length (Amino Acid) 77
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 59
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2912974 2913207 + NC_005085.1 Chromobacterium violaceum ATCC 12472
2 4310437 4310670 + NZ_CP029495.1 Chromobacterium phragmitis
3 903080 903313 + NZ_CP017707.1 Chromobacterium vaccinii
4 1776406 1776639 - NZ_AP019312.1 Chromobacterium haemolyticum
5 1255401 1255634 - NZ_CP047241.1 Aquitalea denitrificans
6 4049180 4049413 + NZ_CP039731.1 Aquitalea aquatilis
7 1231563 1231796 - NZ_CP043473.1 Chromobacterium paludis
8 3380344 3380577 - NZ_CP041335.1 Chitinolyticbacter meiyuanensis
9 625515 625745 - NZ_CP059565.1 Neisseria wadsworthii
10 2218010 2218234 - NZ_CP072524.1 Neisseria sicca
11 228488 228718 + NZ_CP031700.1 Neisseria zalophi
12 2301291 2301482 + NZ_CP059567.1 Neisseria shayeganii
13 2127869 2128099 - NZ_LR134516.1 Neisseria animaloris
14 1921620 1921847 - NZ_CP039887.1 Neisseria subflava
15 1831086 1831313 + NZ_CP039886.1 Neisseria flavescens
16 606316 606546 - NZ_LR134313.1 Neisseria canis
17 1241412 1241642 + NZ_CP022278.1 Neisseria chenwenguii
18 313592 313822 - NZ_LT906434.1 Neisseria zoodegmatis
19 1165029 1165259 + NZ_LR134533.1 Neisseria weaveri
20 1021249 1021476 - NZ_CP046027.1 Neisseria brasiliensis
21 2717816 2718052 + NZ_CP058952.1 Chitinibacter fontanus
22 3657526 3657756 + NZ_CP041730.1 Chitinimonas arctica
23 3403591 3403827 + NZ_CP021395.1 Bordetella hinzii
24 667994 668260 + NC_018518.1 Bordetella pertussis 18323
25 1951278 1951544 + NZ_AP019378.1 Bordetella parapertussis
26 1680602 1680868 + NZ_LR134326.1 Bordetella bronchiseptica
27 2702514 2702750 - NZ_CP043146.1 Bordetella holmesii
28 1634753 1634989 + NZ_CP016440.1 Bordetella pseudohinzii
29 2340340 2340528 - NC_010645.1 Bordetella avium 197N
30 957665 957895 - NZ_CP031699.1 Neisseria animalis
31 1107693 1107917 - NZ_CP031325.1 Neisseria polysaccharea
32 3921364 3921561 - NZ_CP016171.1 Bordetella bronchialis
33 3208904 3209125 - NC_010170.1 Bordetella petrii
34 1376811 1377065 - NZ_CP016210.1 Azoarcus olearius
35 4655221 4655418 - NZ_CP038034.1 Achromobacter insolitus
36 249074 249328 + NC_007614.1 Nitrosospira multiformis ATCC 25196
37 505921 506166 - NZ_AP018721.1 Sulfuritortus calidifontis
38 1552673 1552864 - NZ_CP038018.1 Eikenella exigua
39 131531 131752 + NZ_CP053986.1 Achromobacter denitrificans
40 1613173 1613361 + NZ_CP021520.1 Neisseria meningitidis
41 1235125 1235370 + NZ_CP059560.1 Aromatoleum petrolei
42 4793998 4794195 + NZ_CP046904.1 Massilia flava
43 1539512 1539736 + NZ_LS483369.1 Neisseria cinerea
44 2025565 2025795 + NZ_CP016172.1 Bordetella flabilis
45 2121586 2121774 - NZ_CP031253.1 Neisseria lactamica
46 2905 3129 + NZ_CP059571.1 Neisseria bacilliformis
47 1532234 1532428 + NZ_CP028324.1 Massilia armeniaca
48 2632503 2632748 - NC_006513.1 Aromatoleum aromaticum EbN1
49 785441 785629 + NZ_CP012028.1 Neisseria gonorrhoeae
50 3017554 3017799 - NZ_CP059467.1 Aromatoleum bremense
51 2273447 2273650 - NZ_CP019448.1 Simonsiella muelleri ATCC 29453
52 2786351 2786626 + NZ_AP012547.1 Sulfuritalea hydrogenivorans sk43H
53 1721436 1721672 + NZ_LT907988.1 Orrella dioscoreae
54 4343453 4343641 + NZ_LR134302.1 Achromobacter spanius
55 755726 755992 - NZ_CP010554.1 Rugosibacter aromaticivorans
56 2230542 2230790 - NC_022357.1 Sulfuricella denitrificans skB26
57 571017 571259 + NZ_CP039712.1 Vagococcus zengguangii
58 3097728 3097976 - NZ_CP011568.3 Pandoraea thiooxydans
59 2717148 2717348 + NZ_AP021884.1 Sulfuriferula plumbiphila
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_005085.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00348.19 1.0 59 -10 same-strand Polyprenyl synthetase
2 PF13292.8 0.63 37 952 same-strand 1-deoxy-D-xylulose-5-phosphate synthase
3 PF02779.26 0.63 37 952 same-strand Transketolase, pyrimidine binding domain
4 PF02780.22 0.63 37 952 same-strand Transketolase, C-terminal domain
++ More..