Result : Q7NSG6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsB |
| NCBI Accession ID | AE016825.1 |
| Organism | Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) |
| Left | 3755493 |
| Right | 3755795 |
| Strand | + |
| Nucleotide Sequence | ATGCGCTGGCTGACCGTGACCCTGGTAACCGTGATCCTCGCCCTGCAATGGCCGCTTTGGTTCGGCAAGGGCAGTTGGCTCAGGGTCTGGCAGCTGGACAAGCAGCTGCAGGAACAGCGGGCGACCACCCAAAAGCTGGTCGCCCGCAACGCCGCCCTGGATGCAGAAGTGCGCGATCTGAAACAAGGCAGTGACGCGATCGAGGAAAGAGCTAGGAACGAGCTTGGCATGATCCGCAACGGCGAAGTGTTTTTCCAGTTGCTCGATCCAAGCAAGAACCCCTCCCGGGCGAGTCACCGATAA |
| Sequence | MRWLTVTLVTVILALQWPLWFGKGSWLRVWQLDKQLQEQRATTQKLVARNAALDAEVRDLKQGSDAIEERARNELGMIRNGEVFFQLLDPSKNPSRASHR |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00599}. |
| Pubmed ID | 14500782 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q7NSG6 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3755493 | 3755795 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 2 | 453125 | 453427 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 3 | 1746867 | 1747169 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 4 | 2511739 | 2512062 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 5 | 1119344 | 1119634 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 6 | 4314137 | 4314427 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 7 | 925770 | 926060 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 8 | 1624349 | 1624693 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 9 | 3445355 | 3445684 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 10 | 909375 | 909689 | + | NC_012969.1 | Methylovorus glucosetrophus SIP3-4 |
| 11 | 613902 | 614207 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 12 | 1740628 | 1740921 | + | NZ_CP021106.3 | Nitrosospira lacus |
| 13 | 3556937 | 3557209 | - | NZ_CP053069.1 | Usitatibacter rugosus |
| 14 | 2430085 | 2430423 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 15 | 1655768 | 1656118 | + | NZ_AP022853.1 | Sulfurimicrobium lacus |
| 16 | 485393 | 485677 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 17 | 1413298 | 1413570 | + | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 18 | 2045577 | 2045897 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 19 | 4952797 | 4953075 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 20 | 1197570 | 1197902 | - | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 21 | 2420280 | 2420558 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 22 | 1427237 | 1427575 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 23 | 3655673 | 3655948 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 24 | 1697238 | 1697567 | - | NC_012968.1 | Methylotenera mobilis JLW8 |
| 25 | 533032 | 533358 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 26 | 2929569 | 2929811 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 27 | 1852240 | 1852548 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 28 | 2351865 | 2352137 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 29 | 2383144 | 2383440 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 30 | 1409416 | 1409688 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 31 | 1292644 | 1292901 | + | NZ_CP039287.1 | Cupriavidus necator H16 |
| 32 | 1565831 | 1566103 | - | NZ_CP014646.1 | Thauera humireducens |
| 33 | 2418457 | 2418732 | - | NZ_CP016210.1 | Azoarcus olearius |
| 34 | 2431292 | 2431636 | - | NZ_CP019038.1 | Massilia putida |
| 35 | 3884448 | 3884723 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 36 | 3143283 | 3143591 | - | NZ_CP013341.1 | Nitrosomonas ureae |
| 37 | 1278970 | 1279257 | + | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 38 | 1900282 | 1900557 | - | NZ_CP025682.1 | Azoarcus pumilus |
| 39 | 1506913 | 1507164 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 40 | 1597645 | 1597947 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 41 | 1393714 | 1394031 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 42 | 2168353 | 2168595 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 43 | 1714822 | 1715064 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
| 44 | 1184262 | 1184519 | + | NZ_CP036401.1 | Massilia albidiflava |
| 45 | 1860195 | 1860488 | - | NZ_AP018725.1 | Sulfuriflexus mobilis |
| 46 | 1557530 | 1557784 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 47 | 526122 | 526400 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 48 | 566074 | 566370 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 49 | 3498300 | 3498596 | - | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP043473.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06418.16 | 0.88 | 43 | 2310 | same-strand | CTP synthase N-terminus |
| 2 | PF00117.30 | 0.88 | 43 | 2310 | same-strand | Glutamine amidotransferase class-I |
| 3 | PF00113.24 | 0.92 | 45 | 78 | same-strand | Enolase, C-terminal TIM barrel domain |
| 4 | PF03952.18 | 0.92 | 45 | 78 | same-strand | Enolase, N-terminal domain |
| 5 | PF00793.22 | 0.71 | 35 | 1486 | same-strand | DAHP synthetase I family |
++ More..