Result : Q7NMQ4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 754903 |
| Right | 755121 |
| Strand | - |
| Nucleotide Sequence | ATGCCTTTTGGTCTCGGTCTGCCGGAAATTCTGGTGATTGGCGTGATTGCCCTGTTGATTTTTGGCCCCAAGAAGCTGCCGGAGATGGGGAGCGCTCTGGGCAAGGCGATCCGCGGCTTCAAAAGCGGCGTGAGCGACGAACCGGCCCCACAGCAGAGCGCCTCCAAAGAAACCGCCCCCAATCCTCCCCAGAGCCTGCCCTCGGGCAAGGACTCGTAG |
| Sequence | MPFGLGLPEILVIGVIALLIFGPKKLPEMGSALGKAIRGFKSGVSDEPAPQQSASKETAPNPPQSLPSGKDS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 14621292 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | Q7NMQ4 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 754903 | 755121 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 457143 | 457349 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 6050250 | 6050465 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 4 | 6945959 | 6946141 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 5 | 134749 | 134928 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 6 | 1283576 | 1283782 | + | NZ_CP016312.1 | Thermus brockianus |
| 7 | 1199296 | 1199490 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
++ More..