Result : Q7NML9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP-dependent Clp protease adapter protein ClpS |
| NCBI Accession ID | BA000045.2 |
| Organism | Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) |
| Left | 797909 |
| Right | 798190 |
| Strand | - |
| Nucleotide Sequence | ATGAGCACCGAGACCCTTGAGAGGAAAAGTGTACAGCGCAAACCCATGCCGCTGTACAAAGTTCTGCTGCACAACGACGATCACACGCCGATGAACTATGTGATCGAGGTGTTGATGAAGACCATTCCAAAGATGCAGCCTTCCAAGGCGCGCAAGATCATGCTCGAAGCCCACAATGGCGGGGTGGCGGTGGTGATTGTCTGTGCCCTTGAACACGCCGAATTTTATAGCGAAAGCCTCAACCGCCACAACTTGACTAGCACCTACGAACCGGACTGCTAA |
| Sequence | MSTETLERKSVQRKPMPLYKVLLHNDDHTPMNYVIEVLMKTIPKMQPSKARKIMLEAHNGGVAVVIVCALEHAEFYSESLNRHNLTSTYEPDC |
| Source of smORF | Swiss-Prot |
| Function | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. {ECO:0000255|HAMAP-Rule:MF_00302}. |
| Pubmed ID | 14621292 |
| Domain | CDD:412656 |
| Functional Category | Others |
| Uniprot ID | Q7NML9 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 797909 | 798190 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 2 | 1110004 | 1110285 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 3 | 1077208 | 1077489 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 4 | 3454556 | 3454837 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 5 | 4934660 | 4934941 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 6 | 5672865 | 5673146 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 7 | 711272 | 711550 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
| 8 | 716304 | 716585 | - | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 9 | 1514923 | 1515216 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 10 | 5368706 | 5368987 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 11 | 2854177 | 2854458 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 12 | 1773839 | 1774126 | - | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 13 | 1829925 | 1830230 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 14 | 2811615 | 2811896 | - | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 15 | 1077015 | 1077314 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 16 | 3494821 | 3495102 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 17 | 1813435 | 1813728 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 18 | 3961405 | 3961698 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 19 | 5507445 | 5507726 | - | NZ_CP031941.1 | Nostoc sphaeroides |
| 20 | 4169107 | 4169388 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 21 | 689271 | 689552 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 22 | 6066313 | 6066594 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 23 | 2935173 | 2935454 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 24 | 4916457 | 4916738 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 25 | 498490 | 498771 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 26 | 191027 | 191308 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 27 | 302925 | 303212 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 28 | 4812277 | 4812564 | - | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 29 | 1828928 | 1829218 | - | NZ_CP031115.1 | Rubrobacter indicoceani |
| 30 | 1514341 | 1514589 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 31 | 1824026 | 1824274 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019753.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02517.18 | 0.74 | 23 | 60 | same-strand | Type II CAAX prenyl endopeptidase Rce1-like |
++ More..